KEGG   Xanthomonas campestris pv. raphani: XCR_0350Help
Entry
XCR_0350          CDS       T01872                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xcp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xcp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
389401..390339
Genome map
AA seq 312 aa AA seqDB search
MLEQCMATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDG
PRNPWQAPQAGYRHLDEVVAWNQALMDASYAQLCAGRMPVMLGGDHCLGIGSITAVAKYC
REQHRPLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPQALTHLGGSAPAVLPEQI
RQIGIRSVDPDEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFL
DPSIAPGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLV
ESLFGKSTLMRD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctggagcaatgcatggcaacgcagtacgtgccggtttccctgattggcgtgcccacc
gacatcggtgccggccaccgtggtgcccggatggggccggaggcattgcgcatcgccggg
ctgcaggaggccttggtcgggcgcggcgtcgaggtgcgtgacctgggcaatctggatggc
ccgcgcaatccgtggcaggcaccgcaggccgggtaccggcatctggacgaggtggtcgcc
tggaaccaggcgttgatggacgccagctacgcacagctgtgcgcaggccgcatgccggtc
atgctgggcggcgaccattgcctgggcatcggttcgatcaccgcggtagccaagtactgc
cgcgagcagcatcgcccgctgcgggtgctgtggctggatgcgcattcggacttcaatacc
agcgaggtaaccccgtccggcaacgtgcacggcatgcccgtggcctgcctgtgcggcctt
ggcccgcaggcgctgacccacctgggcggcagcgcgccggccgtgttgcccgagcagatc
cggcagatcggcatccgctcggtggacccggacgagaagcgcctgatcaagcagcaccgc
atcgacgtctacgacatgcgctacatcgacgaagccggcatgaagcgcaccatggaagcg
gccctgcagggcatgagcgccgatacccacctgcatgtgagcttcgatgtggacttcctg
gaccccagcattgcgccgggcgtaggcaccaccgtgccgggtgggccgaactaccgcgag
gcccagctggtgatggagatgatcgccgacaccgggcgaatggggtcgctggatatcgtg
gagctcaatccggtgctggacaaccgcaacgccaccgccgagctggcggtggatctggtg
gaaagcctgttcggcaagtcgacgctgatgcgagattga

DBGET integrated database retrieval system