KEGG   Xanthomonas campestris pv. raphani: XCR_0350Help
Entry
XCR_0350          CDS       T01872                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00220  Arginine biosynthesis
xcp00330  Arginine and proline metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01130  Biosynthesis of antibiotics
xcp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    XCR_0350 (rocF)
   00330 Arginine and proline metabolism
    XCR_0350 (rocF)
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XCR_0350 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEL05278
UniProt: G0CKD2
Position
389401..390339
Genome map
AA seq 312 aa AA seqDB search
MLEQCMATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDG
PRNPWQAPQAGYRHLDEVVAWNQALMDASYAQLCAGRMPVMLGGDHCLGIGSITAVAKYC
REQHRPLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPQALTHLGGSAPAVLPEQI
RQIGIRSVDPDEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFL
DPSIAPGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLV
ESLFGKSTLMRD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctggagcaatgcatggcaacgcagtacgtgccggtttccctgattggcgtgcccacc
gacatcggtgccggccaccgtggtgcccggatggggccggaggcattgcgcatcgccggg
ctgcaggaggccttggtcgggcgcggcgtcgaggtgcgtgacctgggcaatctggatggc
ccgcgcaatccgtggcaggcaccgcaggccgggtaccggcatctggacgaggtggtcgcc
tggaaccaggcgttgatggacgccagctacgcacagctgtgcgcaggccgcatgccggtc
atgctgggcggcgaccattgcctgggcatcggttcgatcaccgcggtagccaagtactgc
cgcgagcagcatcgcccgctgcgggtgctgtggctggatgcgcattcggacttcaatacc
agcgaggtaaccccgtccggcaacgtgcacggcatgcccgtggcctgcctgtgcggcctt
ggcccgcaggcgctgacccacctgggcggcagcgcgccggccgtgttgcccgagcagatc
cggcagatcggcatccgctcggtggacccggacgagaagcgcctgatcaagcagcaccgc
atcgacgtctacgacatgcgctacatcgacgaagccggcatgaagcgcaccatggaagcg
gccctgcagggcatgagcgccgatacccacctgcatgtgagcttcgatgtggacttcctg
gaccccagcattgcgccgggcgtaggcaccaccgtgccgggtgggccgaactaccgcgag
gcccagctggtgatggagatgatcgccgacaccgggcgaatggggtcgctggatatcgtg
gagctcaatccggtgctggacaaccgcaacgccaccgccgagctggcggtggatctggtg
gaaagcctgttcggcaagtcgacgctgatgcgagattga

DBGET integrated database retrieval system