KEGG   Xanthomonas campestris pv. raphani: XCR_0775Help
Entry
XCR_0775          CDS       T01872                                 

Definition
phosphohexose mutases
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_0775
   00030 Pentose phosphate pathway
    XCR_0775
   00051 Fructose and mannose metabolism
    XCR_0775
   00052 Galactose metabolism
    XCR_0775
   00500 Starch and sucrose metabolism
    XCR_0775
   00520 Amino sugar and nucleotide sugar metabolism
    XCR_0775
  Nucleotide metabolism
   00230 Purine metabolism
    XCR_0775
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCR_0775
Enzymes [BR:xcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XCR_0775
    5.4.2.8  phosphomannomutase
     XCR_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(800788..802134)
Genome map
AA seq 448 aa AA seqDB search
MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAG
LRASGREVIDIGLCGTEEVYFQTDHLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDT
GLFAIRDTVAADTAAAGEPTAAEHSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGGAG
LIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKEHGADFGIAWDGDF
DRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEMVEDAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA
RMQKFPCSGEINFKVDDAKAAVARVMAHYGDQSPELDYTDGISADFGQWRFNLRSSNTEP
LLRLNVETRGDAALLETRTQEISNLLRG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacccgccttcaaggcctacgatattcgcggccgcgtgccggatgaactcaac
gaggacttggcccgccgcatcggcgtggcactggcggcgcagctggatcaagggcccgtg
gtcctgggccacgatgtgcgcctggcgagcccggcactgcaggaagccctgtctgccggc
ctgcgtgccagcggccgcgaggtgatcgacattggcctgtgtggcaccgaggaggtctat
ttccagaccgatcacctcaaggccgccggcggcgtgatggtcaccgccagccacaacccg
atggactacaacggcatgaagctggtgcgtgagcaggcgcggccgatcagctccgatacc
ggcctgttcgccatccgcgacacggtcgcggccgacactgccgctgcaggcgagcccacc
gctgccgagcacagccgcaccgacaagaccgcgtatctggagcacctgctcagctacgta
gaccgcagcacgctcaagccgctcaagctggtggtcaacgccggcaacggcggcgccggc
ctgatcgtcgacctgctggcaccgcatctgccattcgaattcgtgcgcgtcttccacgag
cccgatggcaacttccccaacggcatccccaacccgctgctgccggaaaaccgcgacgcc
accgccaaggcggtcaaggaacacggcgccgacttcgggattgcctgggatggcgacttc
gatcgttgcttcttcttcgatcacactggccgcttcatcgagggctattacctggtcggc
ctgctggcgcaagccatcctggccaagcagcccggcggcaaggtcgtgcacgacccgcgc
ctgacctggaacacggtggagatggtggaagacgccggcggcattccggtgctgtgcaag
agtggccacgccttcatcaaggaaaagatgcgcagcgagaacgccgtctatggtggcgaa
atgagcgcgcaccattacttccgcgaattcgcctacgccgactcgggcatgattccgtgg
ctgctgatcgccgagctggtctcgcaatcgggccgttcgctggcggacctggtcgaagcg
cgcatgcagaagttcccctgcagcggcgagatcaatttcaaggtcgacgacgcgaaggcc
gcggttgcacgcgtcatggcgcattacggtgatcagtcaccggagctggattacaccgac
ggcatcagcgccgacttcgggcaatggcgcttcaacctgcgcagctccaacaccgagccg
ctgctgcgtctgaacgtggaaacgcgcggcgatgctgcactgctggagacgcgtacgcag
gaaatttccaacctgttacgcggctga

DBGET integrated database retrieval system