KEGG   Xanthomonas campestris pv. raphani: XCR_0800Help
Entry
XCR_0800          CDS       T01872                                 

Definition
DNA polymerase III holoenzyme chi subunit
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XCR_0800
   00240 Pyrimidine metabolism
    XCR_0800
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XCR_0800
   03430 Mismatch repair
    XCR_0800
   03440 Homologous recombination
    XCR_0800
Enzymes [BR:xcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XCR_0800
DNA replication proteins [BR:xcp03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XCR_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(828219..828644)
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLDEPLRLVCELARKANDANLSTLILARDAAQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIATPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttttacctgatcgccaaaccgcgcttcctcgacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgatgccaacctgtccacgctgatcctggcg
cgcgatgccgcacaggccgaggcgctggatgacctgttgtgggcgttcgacgacgaagcc
tatgtgccgcaccagatcgccggcaccgatgaggaagacgaactggcgccggtgctgatc
gcaacgcccgagttcgccgcgccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtggtgcccgccgaccccgccgcccgcgaa
ccgctgcgcgaacgctggaagcagtacaaggccctgggcctggaactcacgaaatacgac
atgtag

DBGET integrated database retrieval system