KEGG   Xanthomonas campestris pv. raphani: XCR_0808Help
Entry
XCR_0808          CDS       T01872                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Brite
Enzymes [BR:xcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XCR_0808
Secretion system [BR:xcp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XCR_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834726..835520
Genome map
AA seq 264 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASNTAAKPAAAPATGNVDQRVGAALKALDPDFKPD
YIGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFAASEGLLAYRRKQLQTVP
KADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQDHK
EMIAVWCAADRKQALTAAKSGQPVNAKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQLG
GYLPPAQLREALEKRAVTTAGGSR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcattgctcggcgcgatcagccttaccgcctgcgcgcag
tcttcgcagccggccgcgagcaacaccgccgccaagcctgccgccgcaccggccacgggc
aatgtggaccagcgcgtgggcgccgcgctcaaggcgctggacccggacttcaagccggac
tatatcggcgcggccccgttcccgggcttccgcgaagtggtggtgggcgggcaggtgctg
tacgtcagcgatgacggccggtacctgatccaggcgcagccgttcgacatccagaacaag
cagttcgcggccagcgagggcctgctggcctaccgccgcaagcagctgcagaccgttccc
aaggccgaccgcatcgtgttcgcgccggccaacccgaagtacaccgtgacggtgttcacc
gatgtggaatgcggctactgccgcaagctgcacagcgagatcggtgagctcaacaagcag
ggcatcgcggtggaatatctggccttcccgcgcatgggcctgggcagccaggaccacaag
gaaatgatcgcggtgtggtgcgcagccgaccgcaagcaggcgctcaccgcggccaagtcc
ggccagccggtcaacgccaaggactgcaagaacccggtgtcgatggagtacaccctgggc
cagcgcctgggcgtgaacggcaccccggcgatcttcgcgcccgacggcacccagctgggt
ggctacctgccgccggcacagctgcgcgaagcgctggaaaagcgcgcagtcaccacggcg
ggcggcagccgctaa

DBGET integrated database retrieval system