KEGG   Xanthomonas campestris pv. raphani: XCR_0844Help
Entry
XCR_0844          CDS       T01872                                 

Definition
(GenBank) endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
xcp  Xanthomonas campestris pv. raphani
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
881233..882414
Genome map
AA seq 393 aa AA seqDB search
MSSRDQPTPMTRRSLLRVGALSGLAAVLPARVLAAPLQCGAWPLWDAFVAKHIQPDGRVV
DFLNPDQRSTSEGQSYALFFALVNNDAVLFDKVLGWTRHNLCAGRPDLNLPAWLWGRDSS
GEWRVLDPNTASDGELWIAYALLEAGRLWNRPGYTKAGQQVLQLIRAQEVANLPGLGPML
LPGRTGFTAPGRWTLNPSYLPLQVLRRCANADPKGPWAAIALNATRVLRDSAPVGLAPDW
TVWDGKAFSPDPQRGNVGSYDAIRVYLWAGMLDAGEPLRTKLLRDLSGPMDLLAAQGNFA
EKIDTTRGVGTGAAPVGFSAALLPYLSALRQPALLKAQAQRLPAAAQPAAAALPYYERTL
ALFGQGWLENRYRFAADGRLLPAWRTPACSART
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccgcgaccagcccacgccgatgacgcgccgcagcctgctgcgtgtcggtgcg
ttgagcgggctggccgcggtgttgccggcgcgcgtgcttgctgcgccgttgcagtgcggg
gcgtggccgctgtgggatgcgttcgtcgccaagcacatccagcccgacggtcgggtggtg
gactttctcaatcccgaccagcgctccacctccgaaggccagtcgtacgcgctgttcttc
gcactggtgaacaacgacgcggtgctgttcgacaaggtgctgggctggacccggcacaac
ctgtgcgctggccgccccgatctgaatctgccggcctggctgtggggccgcgacagcagc
ggcgaatggcgcgtgctcgaccccaataccgccagcgatggcgagttgtggatcgcctac
gcgttgctggaagccggccgtctgtggaaccgccctggctacaccaaggccggccagcag
gtgctgcagctgatccgcgcgcaggaagtggccaacctgccggggctggggccgatgctg
ctgcccgggcgcaccggattcaccgcgccggggcgctggacgctcaaccccagctacctg
ccgctgcaggtgctgcgccgctgcgccaatgccgaccccaagggcccatgggcggcgatt
gcgctcaacgccacgcgcgtgctgcgcgacagcgcgccggtggggctggcgccggactgg
acggtgtgggacggcaaggccttcagccccgatccccagcgcggcaacgtgggcagctac
gacgccatccgcgtgtatctgtgggccggcatgctcgacgccggcgagccgctgcgcacc
aagctgctgcgggacctgtccgggccaatggacctgctcgccgcgcaaggcaacttcgcc
gaaaagatcgacaccacgcgcggtgtcggcactggcgcggcaccggtcggattttccgcc
gcgctgctgccgtacctgagcgcgctgcgccagccggcgctgctcaaggcgcaggcgcaa
cgcctgccggccgctgcacaaccggcggccgccgcgctgccgtattacgaacgcacgctg
gccctgtttggacagggctggcttgagaaccgctaccgctttgccgcagacgggcgcctg
ctgcccgcctggagaacccctgcatgctccgcaagaacctga

DBGET integrated database retrieval system