KEGG   Xanthomonas campestris pv. raphani: XCR_0887Help
Entry
XCR_0887          CDS       T01872                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:xcp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:xcp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
926052..927539
Genome map
AA seq 495 aa AA seqDB search
MSRTMALSQLLPDVALARDVQVSGLVMDSRAVRPGDAFVAIAGFGAHGLGFAAQALASGA
SAILFEPPAPADLPVPADAIAVPGLRARLGVLADHFHGAPSQTMRMIGVTGTNGKTSTVQ
LLAQALTLLGTPTGTIGTLGVGLYGAVVPTGFTTPLVLQTHAELAQLRDAGAQAVAMEVS
SHALDQGRVDAVQFDVAVFTNLTRDHLDYHGDMAQYGAAKAKLFARAGLRTAVVNLDDAF
GRTLFAALDPALRAIGVSSRAQAGATVQAQDLQLDHHGIQCVLHIGAAAHPVRSPLLGRF
NVDNLLAVAGALYALDIAPAQIAEVLGRLQPIHGRMNRLGGAHGAPLVVVDYAHTPDALE
QALTSLRSHAQDRLICVFGCGGERDTGKRPQMAAIAEVTADVAIVTDDNPRGEDGDVIVA
DILRGFARPDAAIVQRDRAAAIHQAISMAGADDIVLIAGKGHEPYQEVAGVRHAFDDAAV
AAQALLPRTGLGVRV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaccatggcactgtcgcagttgctcccggacgtggcgcttgcacgcgatgtg
caggtgtccggcctggtgatggacagccgtgccgtgcgcccgggcgatgccttcgtggcc
atcgccggcttcggtgcgcatgggctgggatttgccgcacaggcgctggccagcggtgca
tctgccatcctgttcgaaccgccggcgccggccgacctgccggtgcctgccgacgcgatc
gccgtgccggggttgcgcgcgcgcctgggcgtgctggccgaccacttccacggtgcgccg
tcgcagacgatgcgcatgattggtgtcaccggcaccaacggcaaaacctccacggtgcag
ctgctggcgcaggcgctgacgctgctcggcacccccaccggcaccattggcacgctgggc
gtgggcctgtacggcgctgtggtaccgaccgggttcaccacgccgctggtgttgcagacc
cacgccgagctcgcgcaactgcgcgatgccggcgcgcaggcggtggcgatggaagtcagt
tcgcatgcactcgatcagggccgcgtggatgcggtgcagttcgacgtggcggtgttcacc
aatctcacccgcgaccatctcgattatcacggcgacatggcgcagtacggtgcggccaag
gccaagctgttcgcacgcgccgggttgcgcacggcggtcgtgaacctggacgacgccttc
ggccgcacgttgtttgcggcgctggatccggcactgcgcgccatcggcgtgagctcgcgt
gcgcaggccggtgccacggtgcaggcgcaggatttgcagctcgatcaccacggcatccaa
tgcgtgttgcacatcggcgctgcggcgcacccggtgcgctcgccgctgctgggccgtttc
aacgtggataacctgctggccgtggccggcgcgctgtacgcgctcgacatcgcaccggcg
cagatcgccgaagtgctgggccgcttgcagccgatccacggccgcatgaatcgcctgggt
ggtgcgcatggcgcgccgctggtggtggtggactacgcacacacgcctgacgcactggaa
caggcgctcaccagcctgcgttcgcatgcgcaggatcggttgatctgcgtgttcggttgc
ggcggcgaacgcgacaccggcaagcgcccacagatggccgccatcgccgaggtcaccgcc
gatgtggcgatcgtcaccgacgacaacccgcgcggcgaagatggcgatgtgatcgttgcc
gacatcctgcgcgggtttgcgcgtccggatgcggcgatcgtgcagcgcgaccgtgcggcc
gccatccaccaggccatcagcatggccggcgcggacgacatcgtgctgatcgccggcaag
ggccatgagccgtatcaggaagtggccggcgtgcggcatgcattcgacgatgcagcagtg
gctgcgcaggcgttgctgccgcgcaccgggctgggggtgcgcgtatga

DBGET integrated database retrieval system