KEGG   Xanthomonas campestris pv. raphani: XCR_0918Help
Entry
XCR_0918          CDS       T01872                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCR_0918
   01230 Biosynthesis of amino acids
    XCR_0918
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_0918
  Energy metabolism
   00680 Methane metabolism
    XCR_0918
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCR_0918
Enzymes [BR:xcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XCR_0918
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XCR_0918
  Exosomal proteins of melanoma cells
   XCR_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(959033..959620)
Genome map
AA seq 195 aa AA seqDB search
MQQRALHFDQVHVSTLERAQATAAIILHDVAPMPEVVSSAALVERNFGIFAGKNKTLIKK
SVGHAVFERYFHDADGAPPDGEHWMDMYARCKTYYETVLAPLDQQAKHVLVVAHKYIVEV
LALIASGLTPAEYIDFRLPNSCPLSWDELKQLTARSSPHLNTLGELTEIHLLRWMLLATL
GGLHCRAWAPRCHLR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcaacgcgcactgcacttcgaccaggtgcatgtctccacgctggagcgcgcgcag
gcaacggcagccatcatcctgcatgacgttgcgcccatgcccgaggtcgtttccagcgcg
gcactggtggaacgcaacttcggcatcttcgccggcaagaacaagaccttgatcaagaag
tcggtcggccatgcggtgtttgaacgctacttccatgatgccgatggcgcgccaccggac
ggcgaacactggatggatatgtacgcccgctgcaagacctactacgagaccgtgctggcg
ccgctggatcagcaagccaagcacgtgctggtcgtcgcgcacaaatacatcgtggaagtc
ttagcgctgatcgcatccgggctgacgccagcggagtacatcgacttccgcttgcccaac
tcgtgcccgctgtcatgggacgaactcaagcaactgaccgcgcgcagttcgccacacctc
aatacgctgggcgaattgacggaaatccacctgctgcgctggatgctgctcgccacgctt
gggggtttgcactgtcgtgcatgggcgccgcgctgccacctgcgttag

DBGET integrated database retrieval system