KEGG   Xanthomonas campestris pv. raphani: XCR_0958Help
Entry
XCR_0958          CDS       T01872                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XCR_0958
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     XCR_0958
   3.1.2  Thioester hydrolases
    3.1.2.-  
     XCR_0958
Lipid biosynthesis proteins [BR:xcp01004]
 Fatty acid synthase
  Component type
   XCR_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003739..1004392
Genome map
AA seq 217 aa AA seqDB search
MRERTLRYSVMSLWLLTLSLLAPGIASAKSPATAAPILVVGDSLSAAHNIPVQSGWVTLL
DQRLKRDMATPPPVVNASISGETTSGALTRLPGLLQKHRPGVVVIELGGNDALRGLTPAQ
LKGNLEKMIQLSRQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYQTALVPFFLEK
VALQPGLMQADGLHPTAAAQPKVLETVWPALQPLLKP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagaacactgcggtacagcgtgatgagcctgtggctgctgacactctccctg
cttgcgccggggattgcctctgccaaaagtccggccactgccgcgccgatcctggtagtg
ggcgacagcctgagcgccgcgcacaacatcccggtgcagtccggctgggtcaccctgctg
gaccagcgcctgaagcgtgacatggcgacgccaccgccggtcgtcaatgccagcatcagc
ggcgaaaccacctccggcgccttgacccggctgcctgggctgctgcaaaagcaccgcccc
ggcgtggtcgtcatcgaactgggtggcaacgatgccttgcgcggcctcacgccggcccag
ctcaagggcaacctggagaagatgatccagctcagccgtcaggcgggtgcgaaggtcttg
ctgttgggcatcgatgtgccgcccaactatggcccggcctatcgcgagcggttgaaagcg
acctatgccgacctgtccaagcaataccagaccgcgctggtgccgttctttcttgagaag
gtcgccctgcagccgggcctgatgcaggccgacggtctgcaccccaccgccgccgcacag
cccaaggtgctggaaacggtctggccagcactgcagccactgctcaaaccctga

DBGET integrated database retrieval system