KEGG   Xanthomonas campestris pv. raphani: XCR_0958Help
Entry
XCR_0958          CDS       T01872                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xcp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003739..1004392
Genome map
AA seq 217 aa AA seqDB search
MRERTLRYSVMSLWLLTLSLLAPGIASAKSPATAAPILVVGDSLSAAHNIPVQSGWVTLL
DQRLKRDMATPPPVVNASISGETTSGALTRLPGLLQKHRPGVVVIELGGNDALRGLTPAQ
LKGNLEKMIQLSRQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYQTALVPFFLEK
VALQPGLMQADGLHPTAAAQPKVLETVWPALQPLLKP
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagaacactgcggtacagcgtgatgagcctgtggctgctgacactctccctg
cttgcgccggggattgcctctgccaaaagtccggccactgccgcgccgatcctggtagtg
ggcgacagcctgagcgccgcgcacaacatcccggtgcagtccggctgggtcaccctgctg
gaccagcgcctgaagcgtgacatggcgacgccaccgccggtcgtcaatgccagcatcagc
ggcgaaaccacctccggcgccttgacccggctgcctgggctgctgcaaaagcaccgcccc
ggcgtggtcgtcatcgaactgggtggcaacgatgccttgcgcggcctcacgccggcccag
ctcaagggcaacctggagaagatgatccagctcagccgtcaggcgggtgcgaaggtcttg
ctgttgggcatcgatgtgccgcccaactatggcccggcctatcgcgagcggttgaaagcg
acctatgccgacctgtccaagcaataccagaccgcgctggtgccgttctttcttgagaag
gtcgccctgcagccgggcctgatgcaggccgacggtctgcaccccaccgccgccgcacag
cccaaggtgctggaaacggtctggccagcactgcagccactgctcaaaccctga

DBGET integrated database retrieval system