KEGG   Xanthomonas campestris pv. raphani: XCR_1203Help
Entry
XCR_1203          CDS       T01872                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XCR_1203 (recR)
DNA repair and recombination proteins [BR:xcp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XCR_1203 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1219286..1219879
Genome map
AA seq 197 aa AA seqDB search
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALANAVEKVGHCVQCRD
FTESEVCAICANSGRDRQQLCVVESPADRLAIEHATGYRGVYFILQGRLSPLDGIGPREL
GLDRLAERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHSVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccttctggaacaactgatcgaagccttccgggtgctgcccggtgtgggtcag
aagtcggcgcagcgcatggcgtaccacgtgctcgagcgtgagcgcgagggtgggcggcgg
ctggcggcggcgttggccaatgcggtggagaaggtgggccattgcgtgcaatgccgcgac
ttcaccgagtcggaggtgtgcgcgatctgcgccaattccggccgtgaccggcagcagctg
tgcgtggtggaatcgcccgccgatcgcctggcgatcgagcacgccaccggctaccgcggg
gtgtatttcatcctgcaggggcgtttgtcgccgctggatggtatcggcccgcgtgagttg
gggctggaccgcctggccgagcgtctggcagcgggcgaggtcaccgaaatgatcatcgcc
accaacgccaccgtcgagggtgaggccaccgcgcattacctggcgcaactggcccgccaa
cacagcgtgcgccccagccggctcgcacaaggcatgccgctgggcggcgagttggagtac
gtggatcgcggcacgctgtcgcatgcgttcggcacgcgtagtgaggtgctttaa

DBGET integrated database retrieval system