KEGG   Xanthomonas campestris pv. raphani: XCR_1285Help
Entry
XCR_1285          CDS       T01872                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    XCR_1285
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XCR_1285
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     XCR_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1306777..1308096
Genome map
AA seq 439 aa AA seqDB search
MRVSTVDAPTAGHALTEKENSIFVNPQRRFQALLGIGGAITDSSAETFAKLPKQAQRQLL
TAYYDPDKGIGYTLARTTIHSSDFSSGSYTYIKEGDAALKTFSVQHDAKYRIPMLRQAIA
AAGGTLTTFASPWSAPAFMKDSNAMLKGGKLLPAYAQAWATYYTRFIAAYEKAGIPIWGI
SLQNEPMAVQTWESMLFSAEDERDFLKNHLGPTMAKAGYGDRKIIVWDHNRDMMVHRAHV
IFDDPEASKYAWGMGFHWYETWAGFAPMVENVAAVAQAYPDKHLLLTEAAVEKFDPAKLQ
HWPNGERYGTAIINDLNHGAVGWTDWNILLDEHGGPNHVGNYCFAPVHANTRTGEVIYTP
SYWYIGHFSKFIRPGAQRVSAASSRSNLATTAFVNSDGSLATVVMNATDVAIRYNLYVGD
ASSVLEIPAHAIQTVVLAQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcagcactgtcgatgcgcccacggccggacatgcgttgaccgagaaagagaac
tccatcttcgtcaatccacagcggcggtttcaggcgttgctgggcattggtggggcgatc
accgactccagtgcggaaactttcgccaaactgcccaagcaggcgcagcggcaactgctc
accgcctactacgacccggacaagggcatcggctacacgctggcgcggaccaccatccat
agctcggatttcagcagcggcagctacacctacatcaaggaaggcgatgcggcgctgaag
accttttcggtgcagcacgatgcgaaataccgcattccgatgttgcgccaagccattgct
gcggccggtggcacgctcaccacgtttgccagcccgtggagcgcgccggccttcatgaaa
gacagcaacgccatgctcaagggcggcaagctgttgcccgcgtatgcgcaggcctgggcc
acgtactacacgcgcttcattgccgcgtatgaaaaggccggcatcccgatctggggcatc
agcctgcagaacgaaccgatggcggtgcagacctgggagtcgatgctgttctctgcggaa
gacgagcgcgacttcctcaagaatcatctgggcccgaccatggccaaggccggctatggc
gatcgcaagatcatcgtgtgggaccacaaccgcgacatgatggtgcaccgcgcgcatgtg
atcttcgacgatccggaggcttccaaatatgcgtggggcatgggcttccactggtatgaa
acctgggccgggttcgcgccgatggtggagaacgtggcggcggtggcgcaggcgtacccg
gacaagcacctgctgctcaccgaggcggcggtggaaaagttcgacccggccaagctgcag
cactggcccaatggcgagcgctatggcacggccatcatcaacgacctcaatcacggtgcg
gtgggttggacggactggaacatcctgctggacgagcacggtggccccaatcacgtgggc
aactattgctttgcgccggtgcatgccaacacgcgcaccggcgaggtgatctacacgccg
agctattggtatatcggccacttttccaagttcatccggcccggcgcgcagcgggtgagt
gcggcgagcagccgcagcaacctggccaccactgcgttcgtcaacagcgatggcagcctg
gcgacggtggtgatgaatgccacggatgtggcgatccgctacaacctgtatgtgggcgat
gcctccagcgtgctggagattccagcgcatgcgatccagacggtggtgctggcgcagtga

DBGET integrated database retrieval system