KEGG   Xanthomonas campestris pv. raphani: XCR_1416Help
Entry
XCR_1416          CDS       T01872                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCR_1416
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XCR_1416
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XCR_1416
Two-component system [BR:xcp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   XCR_1416
Bacterial motility proteins [BR:xcp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XCR_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1442705..1443292)
Genome map
AA seq 195 aa AA seqDB search
MSPATPQYLEFDAIVIGASAGGVMALQTLLSGLPATLPMPVLVVLHLPRDRPSQVAELLD
ARCALPVREAIDKQPLQAGTVTIAPPDYHLLVEGRDSLALSMDAPVLFSRPAIDPLFESA
ADVFGQRLLAILLTGASSDGSAGVAAVRTAGGSAWIQRPDDAASPLMPASALAHAGADAV
LTLQAICSRLEAFHA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagcccggccacgccgcagtatctggaattcgatgccatcgtgatcggcgcttccgcc
ggtggcgtgatggcattgcagacgctgttgtctggcctgccggccacgctgccgatgccg
gtgctggtggtgctgcatctgccgcgcgaccgccccagccaggtggccgagctgctggat
gcgcgctgcgcgctgcccgtgcgcgaagccatcgacaagcaacctttgcaagccggcacg
gtgaccatcgcgccgccggactatcacctgctggtggaaggccgcgacagcctggcgtta
tcgatggatgcaccggtgctgttctcgcgcccggcgatcgacccgttgttcgaatcggct
gccgatgtgttcggccagcggctgcttgcgatcctgctcaccggtgccagcagcgacggc
agtgccggcgtggccgcggtgcgcactgccggcggaagcgcgtggatccagcgccccgac
gatgccgcctctcccctgatgcccgcctccgccctcgcccatgccggcgccgatgcggtg
ctcaccctgcaggcgatctgcagccgactggaagcctttcacgcatga

DBGET integrated database retrieval system