KEGG   Xanthomonas campestris pv. raphani: XCR_1520Help
Entry
XCR_1520          CDS       T01872                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00071  Fatty acid degradation
xcp00280  Valine, leucine and isoleucine degradation
xcp00281  Geraniol degradation
xcp00310  Lysine degradation
xcp00362  Benzoate degradation
xcp00380  Tryptophan metabolism
xcp00410  beta-Alanine metabolism
xcp00640  Propanoate metabolism
xcp00650  Butanoate metabolism
xcp00903  Limonene and pinene degradation
xcp00930  Caprolactam degradation
xcp01040  Biosynthesis of unsaturated fatty acids
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
xcp01200  Carbon metabolism
xcp01212  Fatty acid metabolism
Module
xcp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XCR_1520
   00650 Butanoate metabolism
    XCR_1520
  Lipid metabolism
   00071 Fatty acid degradation
    XCR_1520
   01040 Biosynthesis of unsaturated fatty acids
    XCR_1520
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCR_1520
   00310 Lysine degradation
    XCR_1520
   00380 Tryptophan metabolism
    XCR_1520
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XCR_1520
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XCR_1520
   00281 Geraniol degradation
    XCR_1520
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCR_1520
   00930 Caprolactam degradation
    XCR_1520
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XCR_1520
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XCR_1520
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XCR_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 ApbA Pyr_redox_2 MORN UDPG_MGDP_dh_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEL06419
UniProt: G0CIV6
Position
complement(1552951..1555023)
Genome map
AA seq 690 aa AA seqDB search
MLPGFDGLRFSHWQADLREDGVLVLSLDRQGAAVNAFSQDVLLELGDVIERLALDPPKGV
VLRSAKANGFIAGADLKEFQEFDRRGTVNDAIRRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLTGRAVS
AKAARAMGLVDKVAAPAVLVDVAAALALAGTTRPFKQRATAWATNTLLARKLLAPQMRKQ
VARKARKEHYPAPYALITTWERAGGGGIQARLAAERKAVVKLASTPAARNLIRIFFLTER
LKALGGKDTGLPAIRHVHVVGAGVMGGDIAAWAAYKGFEVTLQDREQRFIDTALARGGEL
FGKRVKDETKRPAVAARLRGDLAGSGVAQADLVIEAIIENPQAKRDLYQSIEPHLKPDAL
LTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLNVFCKA
LDKFPVPVAGTPGFLVNRVLFPYLLEAATAYAEGIPGPVLDKTAVKFGMPMGPIELIDTV
GLDVAAGVGAELAPFLGLPIPAALATVEAGKRGKKDGQGLYKWENGRAVKPEVASGYEVP
ADLEDRLILPLLNEAVACLHEGVVADADLLDAGVIFGTGFAPFRGGPIQHIRSVGADALL
ARLHALQARYGERFAPRPGWESPVLREPVA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggcagacctgcgcgaggac
ggcgtgctcgtgctcagcctcgaccgccagggcgcggcggtcaacgccttctcgcaggac
gtgctgctcgaactgggcgatgtcatcgaacgcctggcactggatccgcccaagggcgtg
gtgctgcgctcggccaaggccaatggcttcatcgccggcgccgatctgaaggaattccag
gagttcgaccgccgcggcaccgtcaacgacgcaattcgccgcggccagcaggtgttccag
aaactggccgaactgccctgccccacggtggcggccatccatggcttctgcatgggcggc
ggcaccgagattgcactggcctgccgctaccgggtggcctccgacgatggcagcacgcgc
atcgggctgccggaaaccaagctcggcatctttcccggctggggcggcagcgcccgcttg
ccgcgcctgatcggggcaccggcggcaatggacctgatgctcaccgggcgcgcggtgtcg
gccaaggctgcgcgggcgatgggcctggtcgacaaggttgctgcaccggcggtgctggtg
gatgtggctgcggcgctggcattggccggcaccacgcgcccgttcaagcaacgcgccacc
gcctgggcgaccaacaccctgcttgcacgcaagctgctggcaccgcagatgcgcaagcag
gtcgcgcgcaaggcccgcaaggaacactatcccgcgccgtatgcgttgatcaccacctgg
gagcgcgccggtggcggcgggatccaggcccgcctggcggccgagcgcaaggcagtggtc
aagctggccagtacgccggcagcgcgcaatctgatccgcatcttcttcctgaccgagcgg
ctcaaggcccttggcggcaaggacaccggcttgccggccatccgccacgtgcatgtcgtc
ggtgccggcgtgatgggcggcgatatcgccgcgtgggccgcctacaagggcttcgaggtc
acgctgcaggaccgcgaacagcgcttcatcgataccgccctggcgcgcggcggcgaactg
tttggcaagcgcgtaaaggacgagaccaagcgccccgccgtggccgcacgtctgcgcggc
gatctggccggcagcggcgtggcgcaggcggatctggtgatcgaggcgatcatcgaaaac
ccgcaagccaagcgcgacctgtaccaaagcatcgagccgcacctcaagccggatgcgcta
ctcaccaccaacacctcctcgatcccgttgaccgaattgcgcgggcacatccagcgtccg
gcgcagtttgccggcctgcactacttcaacccggtggcgatgatgccgctggtggaaatc
gtgcagcacgacgggctggatccggccaacgtggcgcggctgaacgtgttctgcaaggcg
ctggacaaattcccggtaccggtcgccggcacgccaggattcctggtcaaccgcgtgctg
ttcccgtacttgctggaagcggccaccgcctacgccgagggcattcccgggccagtgctg
gacaagaccgcggtgaagttcggcatgccgatggggccgatcgaactgatcgacaccgtg
ggcctggacgtggccgccggcgtcggtgcggagctcgccccgttcctgggcctgccgatc
ccggcagcattggccacggtggaggccggcaagcgcggcaagaaggacggccagggcttg
tacaagtgggagaacggccgcgcggtcaaacccgaggttgccagcggctacgaggtgccg
gcagacctggaagatcgcctgatcctgccattgctcaacgaagcggtggcctgcctgcac
gaaggcgtggtggccgatgccgacctgctcgatgccggcgtgatcttcggcaccggcttt
gcgcctttccgcggcggcccgatccagcacatccgcagcgtcggtgcagacgcgttgctg
gcccgcctgcacgccttgcaggcgcggtatggcgagcggtttgcaccgcggccgggttgg
gagtcgccggtgttgcgggagccggtggcataa

DBGET integrated database retrieval system