KEGG   Xanthomonas campestris pv. raphani: XCR_1538Help
Entry
XCR_1538          CDS       T01872                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XCR_1538
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    XCR_1538
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XCR_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1571928..1572923
Genome map
AA seq 331 aa AA seqDB search
MLLIGVAGTELSAQERDWLQHDAVAGVVLFKRNFASRTQVAELSAAIRAAAPRPQLICVD
QEGGRVQRFREGYSALAPLQSFGALYATDPEGALAQARAHAQLMASEVRASGVDLSFAPV
VDLARGNRAIGDRAFSDDPQVVASFTRAYVQALHAAGMGATLKHFPGHGTVLEDTHVDHA
SDPRPLDVLLAEDLVPFVAGIDAGADAVMMAHVVYPQVAPEPAGYASRWIEQILRGQLGF
RGVVFSDDIGMAASFSAGGVAGRVHAHLDAGCDVVLVCHPELVAESLQAVAGRTLNTAAL
IGLIGRGALGWDGLLADAPTTSLSASFGTLA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgatcggcgttgccggtaccgaactcagcgcacaggaacgcgactggctgcag
cacgacgccgtcgccggcgtggtgctgttcaagcgcaacttcgcctcgcgcacgcaggtg
gccgagttgtcggccgccatccgcgccgcggcgccgcgcccgcaattgatctgcgtggac
caggaaggcggccgggtgcagcgctttcgcgagggttacagcgccttggcgccgctgcag
agctttggcgcgctgtatgccaccgacccggaaggcgcgcttgcccaggcccgcgcgcat
gcgcagctgatggccagcgaagtgcgcgccagtggtgttgatctcagttttgccccggtg
gtggacctggcacgcggcaaccgcgccatcggcgaccgcgccttcagcgacgacccgcag
gtggtggccagcttcacccgtgcctacgtgcaggcgctgcacgccgccggcatgggcgcc
acgctcaagcatttccccggccacggcaccgtgctggaagacacccatgtcgaccacgcc
agcgacccacggccgctggacgtcctgctggccgaggacctggtgccgttcgtggccggg
atcgacgccggtgccgacgcggtgatgatggcccacgtggtctacccgcaggtggcgccg
gagccggccggctacgcgtcgcgctggatcgagcagatcctgcgcgggcaactgggcttc
cgcggcgtggtcttctccgacgacatcggcatggccgcctcgttcagtgccggcggcgtc
gccggacgggtgcacgcgcacctggatgccggctgcgacgtggtgctggtctgtcatccc
gaactggtcgccgagtccttgcaggcggtggccggccgtacgctcaacactgccgcactg
atcggcctgatcggccgtggcgcgctgggctgggatggcctgctcgccgatgctcccacc
acctccctttccgcctctttcggaacacttgcctga

DBGET integrated database retrieval system