KEGG   Xanthomonas campestris pv. raphani: XCR_1596Help
Entry
XCR_1596          CDS       T01872                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XCR_1596
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    XCR_1596
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     XCR_1596
Lipid biosynthesis proteins [BR:xcp01004]
 Desaturase
  First
   XCR_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621594..1622490)
Genome map
AA seq 298 aa AA seqDB search
MDSQTDEPLDEARADRIDWLRALPFIALHLACFAVFWVGVSWFAVGMAVALYALRMFALT
GFYHRYFSHRAFKTSRVVQFVFAAIAATCVQRGPLWWAAHHRNHHRHTDTGRDPHSPAQH
GFWWSHTGWFLTPRNFRTDWEVIPDLRRFTELRFLDRFDIVMPVLLALGLYLLGDWLAAA
APGLHTSGAQLLVWGFVLSTVALFHATFTINSLAHRFGSRRFDTRDDSRNNWLLALLTFG
EGWHNNHHFFPGSARQGVRWWEYDMTWYGLTVMSWVGLVWDLKPMPAMLTRRAGRVAR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtggattcgcaaaccgacgaaccgctggacgaagcccgcgcggaccgcatcgactggctg
cgcgcgctgccgttcattgccttgcacctggcctgctttgcggtgttctgggtcggtgtg
tcgtggttcgcggtcggcatggccgtggcgctgtacgcgctgcgcatgttcgcgctgacc
gggttctatcaccgctatttttcgcaccgtgcgttcaagacctcgcgcgtggtgcagttc
gtgttcgccgcgatcgccgccacctgcgtgcagcgtgggccgctgtggtgggccgcacac
caccgcaaccatcaccggcataccgacaccggccgtgacccgcattcgccggcacagcac
ggcttctggtggagccataccggctggttcctgaccccgcgcaatttccgcaccgattgg
gaagtgattccggatctgcgccgcttcaccgaactgcgttttctggaccgcttcgacatc
gtgatgccggtgctgctggcactgggcctgtacctgctcggtgactggctggcggctgca
gcgcctggcctgcacaccagtggcgcgcagttgctggtgtggggcttcgtgctgtccacg
gtggcgttgttccatgccaccttcaccatcaattcgctggcgcaccgcttcggcagccgg
cgcttcgacacccgcgacgacagccgcaacaactggctgctggcactgctcaccttcggc
gaaggctggcacaacaaccatcatttctttcccggctcggcgcgccagggcgtgcgttgg
tgggaatacgacatgacctggtacgggctcacggtgatgtcgtgggtgggcctggtgtgg
gatctcaaaccgatgcccgccatgctgacgcgacgcgccggacgggtggcgcgatga

DBGET integrated database retrieval system