KEGG   Xanthomonas campestris pv. raphani: XCR_1658Help
Entry
XCR_1658          CDS       T01872                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xcp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1685379..1687073
Genome map
AA seq 564 aa AA seqDB search
MCSIFGIFGLQPGDDLQALRRQALECSQRQRHRGPDWSGVYVDAGAILVHERLAIVDPAG
GSQPLLSEDGSLALAVNGEIYNHRELKAELLQPYAFQTGSDCEVINALYREDAPASYLNR
LNGIFAFALWDKAAGRVIIARDPIGVVPLYWGHDREGRLRVASELKSLVDDCADAAQFPP
GHWYDSATGALSRYYERSWREYSEVENVQVPLQELREAFERAVHRQLMTDVPYGVLLSGG
LDSSLVAAVAARYARHRIEENDTTEAWWPRLHSFAIGLTGSPDLAAAEVAAAALGTVHHG
FEYSFEEGLDALPEVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFGG
YLYFHKAPNAREFHEELVRKLDALNNYDCLRANKSMMAWGVEPRVPFLDREFLDVAMRMD
ARFKMIDKTSTGATRIEKGILREAFAGYLPESILWRQKEQFSDGVGYGWIDGLKAHAAAH
VSDRELAAADRRFPVNPPQTKEAYFYRSLFEQFFPSQAAAETVPGGKSIACSSPTAIAWD
ASFAAMADPSGRAIAGVHAQALAS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtgttccatcttcggtatcttcggcctgcaacccggcgacgacctgcaggccctgcgc
cggcaggccctggaatgttcgcagcggcaacgccatcgcgggccggactggagcggcgtg
tacgtcgatgccggtgccatcctggtgcacgagcgcctggccatcgtcgacccggcgggc
ggttcgcagccgctgttgtcggaggacggcagcctggcgttggcagtcaacggcgagatc
tataaccatcgcgaactcaaggccgagctactgcagccgtacgcttttcagaccggctcg
gactgcgaagtgatcaatgcgctgtaccgcgaagatgcgccggcctcctatctcaaccgc
ctcaatggcatcttcgcctttgcgttgtgggacaaggccgcggggcgggtgatcatcgcg
cgcgacccgatcggcgtggtgccgttgtactggggccacgaccgcgaaggtcgcctgcgc
gtggcgtccgaactcaagtcgctggtggacgattgcgccgatgccgcgcagtttccgcct
ggccattggtacgacagcgccaccggcgcattgagccgctactacgagcgctcgtggcgc
gaatacagcgaagtggaaaacgtgcaggtgccgctgcaagagctgcgcgaggcgttcgag
cgcgcggtgcatcgccagctgatgaccgacgtgccctacggtgtgctgctgtccggtggc
ctggattcgtcgttggtggcagcggtggccgcacgctacgcgcggcatcgcatcgaagag
aacgacaccaccgaagcctggtggccgcgtctgcattcgttcgcaatcggcctgaccggc
tcgccggatctggccgctgccgaagtggccgccgccgcgctcggtaccgtgcaccatggc
ttcgaatacagctttgaagaaggcctggatgcgttgccggaagtgatccgccatatcgaa
acctatgacgtgaccacgattcgtgcgtccacgccgatgttcctgctggcgcggcgcatc
aaggcgatgggcgtcaagatggtgctgtccggcgaaggcagcgacgagatcttcggtggc
tacctgtacttccacaaggcaccgaacgcacgcgaattccacgaagaactggtgcgcaag
ctcgatgcgctcaacaactacgattgcctgcgcgccaacaagtcgatgatggcctggggc
gtggaaccgcgcgtgccgttcctggatcgcgaattcctggacgtggcgatgcgcatggac
gcgcgcttcaagatgatcgacaagaccagcaccggtgccacccgcatcgagaaaggcatc
ttgcgcgaggcatttgccggctatctgccggaatcgatcctgtggcggcagaaggagcaa
ttcagcgatggcgttggttatggctggatcgacggcctcaaggcacatgccgccgcgcac
gtgagcgatcgcgaactggcggcggccgatcggcgcttcccggtgaacccgccgcagacc
aaggaagcgtatttctaccgcagtctgttcgagcagttcttcccaagccaggccgctgcg
gagacggtgccgggcggtaaatccatcgcgtgttcgtcgccgacggccattgcctgggac
gcgagctttgcggcgatggccgatccgtcgggccgtgcgattgccggcgtgcacgcgcag
gcgttggcgtcctga

DBGET integrated database retrieval system