KEGG   Xanthomonas campestris pv. raphani: XCR_1685Help
Entry
XCR_1685          CDS       T01872                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XCR_1685
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XCR_1685
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XCR_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1717809..1718294
Genome map
AA seq 161 aa AA seqDB search
MTTLSTYQFTDLDGQPQSLAEYAGKVVLVVNVASKCGFTPQYAGLQALWQRYRDRGLVVI
GFPCDQFGHQEPGDAADIRQFCSLDYAVDFPLAAKVEVNGSGAHPLWQWLKHEKRGVLGS
EAIKWNFTKFLIGRDGSVLERYAPTTKPEALAADIERALGA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctctccacctaccagttcaccgacctggacggtcaaccccagtcgctggcc
gagtacgccggcaaggtggtgctcgtggtcaacgtggcctccaaatgtggttttacgccg
cagtacgccggcctgcaggcgctgtggcagcgctaccgcgaccgcgggctggtggtgatc
gggtttccctgcgatcagttcggtcatcaggagcctggagatgcggcggacatccgccag
ttctgctcgctggactacgcggtggattttccgctcgcggccaaggtcgaggtcaatggc
agcggcgcccacccgctatggcaatggctcaagcacgaaaaacgcggcgtgctgggctcg
gaagcgatcaagtggaatttcaccaaattcctgatcggccgcgatggcagtgtgctggag
cgctatgcgccgaccaccaaaccggaggcgctggcggcggatatcgaacgcgcgctgggc
gcttga

DBGET integrated database retrieval system