KEGG   Xanthomonas campestris pv. raphani: XCR_1750Help
Entry
XCR_1750          CDS       T01872                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00020  Citrate cycle (TCA cycle)
xcp00310  Lysine degradation
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
xcp01200  Carbon metabolism
Module
xcp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XCR_1750 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XCR_1750 (sucB)
Enzymes [BR:xcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XCR_1750 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2486 GCV_H SAPS
Motif
Other DBs
NCBI-ProteinID: AEL06648
UniProt: G0CLJ8
Position
complement(1786126..1787340)
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPAEEKKADAPAAAAAPAAVPAPAAAAAAAPVASKS
SADSLPPGARFSAITQGVDPSQVDGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVAM
TRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKA
AANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERQSFAEVEQGIAD
YAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggtgaagcggtcaagcgcgacgagaatctggtcgatctggaa
accgacaaggtcgtgttggaagttccttcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcaccgtcaccagcaaccagatcctggcgatcatcgaagaaggcgcc
gtggccgcggctgcaccggccgaagagaagaaggccgatgccccggcggccgccgctgcg
cctgctgctgtgccggcaccggctgccgctgccgctgccgcgccggttgcatcgaagtcg
tctgccgacagcctgccgccgggtgcgcgtttttccgccatcacccagggcgtggatccg
tcgcaggtcgacggcaccggccgtcgtggcgcggtgaccaaggaagatatcgtcaacttc
gccaaggccggcggcgtgggcaaggcatctggcgcccgcccggaagagcgcgtggcgatg
acccgcgtgcgcaagacgatcgccaagcgcctgatggagtccaagaattccaccgcaatg
ctgaccaccttcaacgaggtcaacctcgccaaggtgtcggccgcgcgcaaggaactgcag
gacgaattccagaaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggcc
gccgccaacgcactgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatc
atctatcacggctacagcgacatctcgatcgccgtctccaccgagaagggcctggtgacg
ccggtgctgcgtaacgtcgagcgccagtcgttcgccgaagtcgaacagggcatcgccgac
tacgccgccaaggcgcgcgccggcaagctgggcctggacgacctgcagggtggcaccttc
accatcaccaatggcggcaccttcggctcgctgttgtcgaccccgatcatcaacccgccg
cagagcgccatcctgggcatgcacgcgatcaaggaacgtccgatcgccgagaacggccag
gtcgtgatcgcgccgatgatgtacctggcgctgtcctacgatcaccgcatcatcgacggc
aaggattcggtgcagttcctggtcgacatcaagaatcagctggaaaacccgggccggatg
ctgtttggcctctaa

DBGET integrated database retrieval system