KEGG   Xanthomonas campestris pv. raphani: XCR_1768Help
Entry
XCR_1768          CDS       T01872                                 

Definition
ABC transporter vitamin B12 uptake permease
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XCR_1768
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XCR_1768
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XCR_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1803771..1804328
Genome map
AA seq 185 aa AA seqDB search
MSLNRLLVLVFAGLFSTAAAAAGTSVLDLDYRPLAGKAPINLNRSYGGKVVMVVNTASKC
GFTPQYEGLEALNQRFGSRGFTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTRETGVAPGWNFHKYLIGRNGQVVAQFPSKVKPDDPQVLAAIEREL
KAPAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcaatcgtctgttggtccttgtatttgctggacttttttccactgctgcggcg
gcggccggtacctcggtgctggatctggactaccgcccgctggccggcaaggccccaatc
aacctgaaccgtagttacggcggcaaggtggtgatggtggtcaacaccgccagcaagtgc
ggcttcaccccgcagtacgaaggcctggaagcgctcaatcagcgcttcggcagccgcggg
ttcacggtgctcggcttcccgtccaacgatttccaggggcaggaacccggatctgagaaa
cagatccaggaattctgcacgctgacctatggcgtcaagttcccgatgtttgagaaggtg
catgtgctgggcgcgcaggcgaccccgctgtatcagcgactgacgcgcgagaccggcgtg
gcgccgggttggaacttccacaagtatttgatcggtcgcaatggacaggtggtggcgcag
ttcccgagcaaggtcaagccggacgacccgcaggtgctggcggcgatcgagcgcgagctc
aaggcgccagcacgctga

DBGET integrated database retrieval system