KEGG   Xanthomonas campestris pv. raphani: XCR_1903Help
Entry
XCR_1903          CDS       T01872                                 

Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xcp00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xcp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1939465..1939860)
Genome map
AA seq 131 aa AA seqDB search
MHPFHKTLLCAPLAGLLLAGATLAPPARAADGAGKDTFMAECAECHSATQGKNKKGPSMF
GIGNRQAASLPDYSNYSDALKNSKWQWTPAQLKTYLSQSSSKALPGTKMKYEGLDDPKEL
DALIVYLNSLK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcatccattccacaagaccctgttgtgcgccccgctcgccggcctgctattggccggc
gccaccctggcaccgccggcacgtgccgccgacggtgcgggcaaggacaccttcatggcc
gaatgcgccgaatgccacagcgcaacgcaaggcaagaacaagaaaggcccgtccatgttc
ggcattggcaaccgccaggcggccagcctgccggactacagcaactactccgacgcgctc
aagaacagcaagtggcagtggacgccggcacagctgaagacctacctgtcgcagtcttcg
tccaaggcgctgcccggcaccaagatgaagtacgaaggcctggatgatcccaaggagttg
gacgcactcatcgtctatctcaacagcctcaaatga

DBGET integrated database retrieval system