KEGG   Xanthomonas campestris pv. raphani: XCR_1903Help
Entry
XCR_1903          CDS       T01872                                 

Definition
(GenBank) cytochrome C2
  KO
K08738  cytochrome c
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCR_1903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEL06796
UniProt: G0CAG1
Position
complement(1939465..1939860)
Genome map
AA seq 131 aa AA seqDB search
MHPFHKTLLCAPLAGLLLAGATLAPPARAADGAGKDTFMAECAECHSATQGKNKKGPSMF
GIGNRQAASLPDYSNYSDALKNSKWQWTPAQLKTYLSQSSSKALPGTKMKYEGLDDPKEL
DALIVYLNSLK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcatccattccacaagaccctgttgtgcgccccgctcgccggcctgctattggccggc
gccaccctggcaccgccggcacgtgccgccgacggtgcgggcaaggacaccttcatggcc
gaatgcgccgaatgccacagcgcaacgcaaggcaagaacaagaaaggcccgtccatgttc
ggcattggcaaccgccaggcggccagcctgccggactacagcaactactccgacgcgctc
aagaacagcaagtggcagtggacgccggcacagctgaagacctacctgtcgcagtcttcg
tccaaggcgctgcccggcaccaagatgaagtacgaaggcctggatgatcccaaggagttg
gacgcactcatcgtctatctcaacagcctcaaatga

DBGET integrated database retrieval system