KEGG   Xanthomonas campestris pv. raphani: XCR_1943Help
Entry
XCR_1943          CDS       T01872                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xcp  Xanthomonas campestris pv. raphani
Brite
Enzymes [BR:xcp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XCR_1943 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1982168..1982845
Genome map
AA seq 225 aa AA seqDB search
MTPRLRLQPESVGIGMTSQRVRDRLVERLRESGIQDEATLNAVRTVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVAPKKVLEVGTGSGYQGAILAALGLEVYTVE
RIGDLLRQARKRFRHLGMNVRSKHDDGRIGWPEHGPYDAIVVTAAAPALVDALVDQLAVG
GRLVAPVGGASSQSLVQLTRGADGEIAQEVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcggctgcgcctgcaaccggaatcggtggggattggtatgacctcgcagcgg
gtgcgcgaccgtctggtcgagcgtctgcgcgagtccggtatccaggacgaagccacgctc
aacgccgtgcgcaccgtgccgcgtcatctgttcatcgatgaagcgctggcctcgcgcgct
tacgaagacaccgcgctgccgatcggccatggccagaccatttcccagccatgggtggtc
gcgcgcatgaccgaggcggtgctgcaggtggcgccgaagaaagtgctcgaagtgggcacc
ggctctggctaccagggcgcgatcctggcggcactgggcctggaggtctataccgtcgag
cgcatcggcgatctgctgcgccaggcgcgcaagcgctttcgccatctgggcatgaacgtg
cgcagcaagcacgacgatggccggatcggctggccggagcacggaccctatgatgcgatc
gtggtcaccgcggccgcgccggcgctggtcgacgccttggtcgatcagttggcggtcggt
ggccggttggtggccccggtcggtggcgcctcgtcgcaatcgctggtgcagctgacgcgc
ggcgccgatggcgagatcgcgcaagaggttctggcgccggtcacgttcgtcccgctgttg
tcgggcatgctggattga

DBGET integrated database retrieval system