KEGG   Xanthomonas campestris pv. raphani: XCR_1950Help
Entry
XCR_1950          CDS       T01872                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xcp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1988169..1989071
Genome map
AA seq 300 aa AA seqDB search
MFDTTPQLNCAGRLLRLDGPQVMGIVNVTPDSFSDGGQHTTVDAAVAHGLRLVAEGAAVL
DVGGESTRPGASAVSLEEELQRVIPVIQALSAQTAVPISVDTYKPEVMRAAVAAGAGMIN
DVHALRSPGALEAAAELAVPVVLMHALSAPHAMQAEPHYDDVVAEVHRFLAERIFAAEMA
GIDKRRLILDPGFGFDKSTVHNLTVLAQLQRLQEFGLPVLAGFSRKRTIGELTGRQVAAD
RVHGSVAAHLIAAQQGAQLLRVHDVAATVDALKVWRAVAAIPTPRVAAAAAPTIRWPDED
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccacaccgcaattgaactgcgccggccgcctcctgcgcctggatggcccg
caggtgatgggcatcgtcaatgtcacgccggactcgttctccgatggcggtcagcacacg
acggtggacgcggcggtggcccatgggctgcgactggtcgcagaaggtgcggcggtgctg
gatgtgggcggtgaatccacccggcctggcgccagtgcggtatcgctggaagaggaactg
cagcgggtgatcccggtgatccaggccctgagcgcgcagaccgctgtgccgatcagcgtg
gacacctacaagcccgaggtcatgcgcgccgcagtcgccgcgggcgcgggcatgatcaac
gatgtacacgcgttgcggtcgccgggcgcgctggaggccgctgcggaactcgcagtgccg
gtggtgctgatgcatgcgctgagcgcaccgcacgcgatgcaggccgagccgcattacgac
gatgtggtggccgaggtgcatcgctttctggccgagcgcatttttgctgcggaaatggct
ggcatcgacaagcggcggctgatcctcgaccccggattcggcttcgacaaaagtaccgtg
cacaacctcacagtgctggcgcaactgcagcggctccaggaatttggcctgccggtgctc
gcgggattctcgcgcaagcgcacgatcggcgaattgaccggtcgccaggttgcggccgac
cgcgtgcatggctcggtggccgcccatctgatcgccgcccagcagggcgcgcaactgctg
cgcgtgcatgacgtggcggcgaccgtggatgcgttgaaggtatggcgtgcggtggctgca
attcccaccccgcgcgtggcagcagctgcggcgccaacgattcgctggccggacgaggac
tga

DBGET integrated database retrieval system