KEGG   Xanthomonas campestris pv. raphani: XCR_2119Help
Entry
XCR_2119          CDS       T01872                                 

Definition
two-component system response regulator protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XCR_2119
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XCR_2119
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XCR_2119
Two-component system [BR:xcp02022]
 CheA family
  CheA-CheYBV
   XCR_2119
Bacterial motility proteins [BR:xcp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XCR_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2186592..2187668)
Genome map
AA seq 358 aa AA seqDB search
MTLETPVRVLIVDDSAVVRQMLTEILSRDPGIEVVGSAADPLLAREKIKRLNPDVITLDV
EMPRMDGLVFLENLMRLRPTPVVMISSLTERGADTTLQALSLGAVDFISKPKIDVARGLE
GYAEEIVSKVKMAAKAKVSALNRPSAPKITLDMQSAPVPGSALRFRTTDRLIAIGASAGG
TEALRVVLEHMPADAPAVVMTQHLPASFSTAFAERLNRHSAMSVREASDGEAILPGHAYL
PPGGQHLRIIRDGARWRCRIDDGPPVNRHKPAVDVLFRSVAANAGPNAVGAILTGMGDDG
ARGLLEMLQAGAPTLVQDEASSVVWGMPGAAYKLGAAQEVVPLERVAERLIALSAQAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggaaactcctgtgcgtgtgttgatcgtcgacgactcggcggttgtgcgtcag
atgctcaccgaaatcctctcgcgcgaccccggcatcgaagtcgtcggctcggccgccgac
ccgttgctcgcgcgcgaaaagatcaaacgcctcaatccggacgtgatcacgctggatgtg
gaaatgccgcgcatggacgggctggtgttcctcgaaaacctcatgcgcctgcgccccacc
ccggtggtcatgatttcctcgctgaccgaacgcggcgccgacaccacgctgcaggccctg
tcgctgggcgcggtggatttcatctccaagcccaagatcgacgttgcgcgcggcctggaa
ggctacgccgaagaaatcgtcagcaaggtcaagatggctgccaaggccaaggtgagcgcg
ctcaatcgtcccagcgcgcccaagatcaccctggacatgcagtccgcgcccgtgccgggc
agcgcgctgcgtttccgcacgactgaccgcctgattgccatcggtgcctccgccggcggc
accgaggcactgcgcgtggtgctggaacacatgcccgccgacgcccctgcggtggtcatg
acccagcatctgccggccagcttcagcaccgcatttgccgagcgcctgaatcgccactcg
gcgatgtcggtgcgcgaagccagcgacggcgaagccattctgccgggccacgcctacctg
ccgccgggcggccagcatctgcgcatcatccgagacggtgcgcgctggcgctgccgtatc
gacgacggcccgccggtcaaccgccacaagccggcagtggacgtgctgttccgttccgtt
gccgccaacgctggcccgaatgcggtcggcgccatcctcaccggcatgggcgacgacggc
gcacgcggcctgctggaaatgctgcaggccggtgcgcccacgctggtgcaggacgaagct
agcagcgtggtctggggtatgcccggggctgcctacaaactgggcgctgcgcaggaagtg
gtgccactggaacgcgtggccgaacgcctcatcgcgctgtcggcacaggcacgctga

DBGET integrated database retrieval system