KEGG   Xanthomonas campestris pv. raphani: XCR_2302Help
Entry
XCR_2302          CDS       T01872                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xcp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xcp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2393513..2394565
Genome map
AA seq 350 aa AA seqDB search
MTIENNRNIVAIGGSAGASQALRTLLADLPRDLPAAVLVVLHLSPQGTGIAEMVRSAVRG
LPVHVASDGMPLVPGAVYVAVPDSHLMVDGMHVVLGRGPRENMSRPSIDALFRSVAVSHG
ARALGVLLSGMLNDGCAGLEAIQACGGAVAVQDPDDAIADDMPRNALRALTPDVVAPSAA
LGAVITDLVREPAAWPIAPSDALKLEVAIARGQPSTTEVMTQLGEAVALSCPACGGVLTK
LHTPGTLRFRCQVGHGYTAPALMSAKEGSVDEALRVALRVIEERAELVSRMAGDDRVHQP
SVASLYAARAKEYRGYADVLRSALLTSLQRPVEHGALVEDGALLTQEDQH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattgaaaataaccgcaacatcgtggcgatcggcgggtcggcaggcgccagccag
gcgctgcgcacgctgctggcagacctgccgcgcgatcttcccgccgcggtgctagtggtg
ctgcatctgtcgccgcaaggcacgggcatcgcggagatggtgcgcagcgcagtgcgcggc
ttgccggtgcacgtggccagtgatggcatgcccttggtgccgggtgcggtgtatgtggcc
gtgccggactcccacctgatggtcgatggcatgcacgtcgtgctggggcgcgggccacgc
gagaacatgtcgcggccgtcgatcgatgccttgttccgctccgttgcggtctcacacggc
gcacgcgcgttgggggtgctgctgtcgggcatgctcaacgatggctgcgccggcttggaa
gccatccaggcctgcggtggtgcggtggcggtgcaagacccggacgatgcaatcgccgac
gacatgccgcgcaacgcgctgcgtgcgcttaccccggacgtggtggcacccagtgcggcc
ctgggtgcggtcatcaccgatctggtgcgcgaaccggcggcctggccgatcgcgccgtcg
gatgcgctcaagctggaggtcgcgatcgcgcgcgggcagccgtccaccaccgaggtgatg
acgcagctgggggaggcggtggcgctcagctgcccggcgtgtggcggggtgctgaccaag
ctgcatacaccggggacgctgcgttttcgttgccaggtcggtcatggctacaccgcgccc
gcactgatgtccgcaaaggaaggctcggtggatgaggcgctgcgcgtggccttgcgcgtg
atcgaagaacgcgccgaattggtgagccggatggccggggacgaccgcgttcaccagcca
tcggttgcctcgctgtatgccgcgcgtgctaaggaataccgcggctatgcggatgtgttg
cgcagcgccttattgacttcactgcagcgcccggtcgaacacggcgcgcttgtcgaagac
ggcgcgttgctgacgcaggaagatcagcattaa

DBGET integrated database retrieval system