KEGG   Xanthomonas campestris pv. raphani: XCR_2404Help
Entry
XCR_2404          CDS       T01872                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:xcp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xcp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xcp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xcp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:xcp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2509243..2510250
Genome map
AA seq 335 aa AA seqDB search
MTAPSKPVLVADIGGTNARFALADIDASVPLLEDTCREFAVVEFGSLGEAARYYLDQIGV
QATKGVFAVAGRVDGDEARITNHPWVISRSRTATMLGFSTLHLINDFAAQAMAISLLRPQ
DVVQVGGASWRPAPIEQPRNYGVIGPGTGLGVGGLIIRNGRCFPLETEGGHVSFPPGTPE
EIRVLEILSEQFGRVSNERLICGPGLVNIHRALSEIAGIDPGPLEPKDITARAAAGDPRA
SRTIDLFCAIFGAIAGDMVLMQGAWDGVFLTGGLVPKVLDSLQHSGFRQRFEHKGRFSAI
MSRVPSLAVMHPHAGLLGAAAYAVDAERALPGEQR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccttccaagccggtgctggttgccgacatcggtggcaccaacgcgcgcttt
gcgctggccgacatcgatgcctcggtaccgctgctggaggacacctgccgtgagttcgcg
gtggtcgagttcggctcgctgggcgaggccgcgcgctattacctggaccagatcggcgtg
caggccaccaagggcgtgttcgcggtggccggccgcgtggatggcgacgaagcccgcatc
accaaccacccgtgggtgatctcgcgctcgcgtaccgccaccatgctgggcttcagcacg
ctacacctgatcaacgacttcgccgcgcaagcgatggcgatcagcctgctgcgcccgcag
gacgtggtgcaggtgggcggcgccagctggcgcccggcaccgatcgagcagccgcgcaac
tacggcgtcatcggcccgggcaccgggctgggcgtaggtggcctgatcatccgcaatggg
cgctgttttccgctggaaaccgaaggcggccacgtcagcttcccgcccggcacgccggaa
gagattcgcgtgctggagatcctgtccgagcagttcggccgggtctccaacgagcgcctg
atctgcggcccgggcctggttaacatccaccgcgcgctgagcgagattgccggcatcgac
cccggcccgctggagcccaaggacatcaccgcacgcgccgccgccggcgacccgcgtgcc
tcgcgcaccattgatctgttctgcgccatcttcggcgcgatcgccggtgacatggtgctg
atgcagggtgcctgggacggcgtcttcctcactggcgggctggtgcccaaggtgctggat
tcgctgcagcattccggcttccgccagcgcttcgaacacaagggccgtttctccgcgatc
atgtcgcgggtgccctcgctggcggtgatgcatccgcatgccggcctgctgggtgcagcg
gcgtatgcggtggacgccgaacgcgcattgccgggagagcagcgatga

DBGET integrated database retrieval system