KEGG   Xanthomonas campestris pv. raphani: XCR_2431Help
Entry
XCR_2431          CDS       T01872                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    XCR_2431
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    XCR_2431
Enzymes [BR:xcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     XCR_2431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2537568..2538326
Genome map
AA seq 252 aa AA seqDB search
MRSILITGAGSGIGAGLATVLAADGHHLLVSDADLAAAEQTTQQVRAAGGSAEALALDVT
DEHSIAQALAAASRAPEVLVNNAGLQHVAPLEEFPMQRWALLVDVMLTGAARLSRAVLPG
MRAGGYGRIVNIGSIHSLVASPYKSAYVATKHGLIGLSKVLALETADCDITANTLCPSYV
RTPLVERQIADQARTRGIAEDTVIREVMLKPMPKGAFIEYDELAGTVAFLMSHAARNLTG
QAIAIDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcctgatcaccggtgccggcagcggcatcggcgccggcctggccaccgtt
cttgccgccgacggccaccacctgctggtgagcgacgccgacctggccgcggccgagcag
accacccagcaggtgcgcgcggccggcggatcggccgaggccttggcactggacgtcacc
gacgagcacagcattgcccaggcactggcggccgcctcgcgcgcgcccgaggtgttggtc
aacaacgccggcctgcagcacgttgcgccgctggaggagttcccgatgcagcgctgggcg
ctgctggtggacgtgatgctgaccggtgccgcacgtctcagccgcgcggtgctaccgggc
atgcgggcgggcggctacgggcgcatcgtcaacatcggcagcatccattcgctggtggcc
agcccttacaagagcgcctacgtggctaccaagcacgggctgatcgggctgtccaaggtg
ctcgcgctggaaaccgccgactgcgacatcaccgccaacacgctgtgccccagctacgtg
cgcacgccgctggtggagcggcagatcgccgaccaggcacgcacgcgcggcattgccgaa
gacacggtgatccgcgaagtgatgctcaagccgatgcccaaaggcgccttcatcgagtac
gacgaactggccggcacggtggccttcctgatgtcgcacgcggcgcgcaatctcaccggc
caggccatcgccatcgacggtggctggaccgcgcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system