KEGG   Xanthomonas campestris pv. raphani: XCR_2431Help
Entry
XCR_2431          CDS       T01872                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:xcp00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:xcp00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2537568..2538326
Genome map
AA seq 252 aa AA seqDB search
MRSILITGAGSGIGAGLATVLAADGHHLLVSDADLAAAEQTTQQVRAAGGSAEALALDVT
DEHSIAQALAAASRAPEVLVNNAGLQHVAPLEEFPMQRWALLVDVMLTGAARLSRAVLPG
MRAGGYGRIVNIGSIHSLVASPYKSAYVATKHGLIGLSKVLALETADCDITANTLCPSYV
RTPLVERQIADQARTRGIAEDTVIREVMLKPMPKGAFIEYDELAGTVAFLMSHAARNLTG
QAIAIDGGWTAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatcctgatcaccggtgccggcagcggcatcggcgccggcctggccaccgtt
cttgccgccgacggccaccacctgctggtgagcgacgccgacctggccgcggccgagcag
accacccagcaggtgcgcgcggccggcggatcggccgaggccttggcactggacgtcacc
gacgagcacagcattgcccaggcactggcggccgcctcgcgcgcgcccgaggtgttggtc
aacaacgccggcctgcagcacgttgcgccgctggaggagttcccgatgcagcgctgggcg
ctgctggtggacgtgatgctgaccggtgccgcacgtctcagccgcgcggtgctaccgggc
atgcgggcgggcggctacgggcgcatcgtcaacatcggcagcatccattcgctggtggcc
agcccttacaagagcgcctacgtggctaccaagcacgggctgatcgggctgtccaaggtg
ctcgcgctggaaaccgccgactgcgacatcaccgccaacacgctgtgccccagctacgtg
cgcacgccgctggtggagcggcagatcgccgaccaggcacgcacgcgcggcattgccgaa
gacacggtgatccgcgaagtgatgctcaagccgatgcccaaaggcgccttcatcgagtac
gacgaactggccggcacggtggccttcctgatgtcgcacgcggcgcgcaatctcaccggc
caggccatcgccatcgacggtggctggaccgcgcaatga

DBGET integrated database retrieval system