KEGG   Xanthomonas campestris pv. raphani: XCR_2456Help
Entry
XCR_2456          CDS       T01872                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCR_2456
   00052 Galactose metabolism
    XCR_2456
   00500 Starch and sucrose metabolism
    XCR_2456
   00520 Amino sugar and nucleotide sugar metabolism
    XCR_2456
Enzymes [BR:xcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XCR_2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2567801..2568619)
Genome map
AA seq 272 aa AA seqDB search
MPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKL
EQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMWNRGDAAL
TQMADVAEASGGSVIAVEDVPHDKTASYGIVSTDAFDGRKGRINAIVEKPKPEVAPSNLA
VVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAELLKQEQVDAFRFEGRRFDCGAHIGLI
EATVHFALEHDKHGAPAKEIIRSALAAADARG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaaggaaatgctgccgatcatcgataaaccgcttatccagtacgccgtggacgaa
gccatccaggccggttgcgatacgctgatcttcgtcaccaatcgctacaagcactcgatc
gccgactacttcgacaaggcctatgagctggagcagaagctcgagcgcgcaggcaagctc
gagcaactggagctggtgcgccatgcactccccgagggcgtccgcgccatttttgtgacg
caggccgaagcgctcggcctgggccacgcggtgctgtgtgccaaggccgtggtcggtgac
gaaccgttcgcagtgctgctgcccgacgacctgatgtggaaccgcggcgatgcggcgctg
acccagatggccgatgtggcggaagcctccggcggcagcgtgatcgccgtggaagatgtg
ccgcacgacaagacggccagttatggcatcgtgtccaccgatgcgttcgacggccgcaag
ggccgcatcaatgccatcgtcgaaaagcccaagccggaagtggcgccgagcaatctggca
gtcgtcggtcgttacgtgctcagcccgaagatcttcgagtacctggagtccacgggcgcc
ggtgcaggtggcgagatccagctcaccgatgcgatcgccgagctgctcaagcaggaacag
gtcgacgcgttccgtttcgagggccgtcgcttcgactgcggcgcgcacatcggtttgatc
gaggccacggtgcactttgcgctcgagcacgacaagcatggcgcaccggccaaggaaatc
attcgcagcgccttggctgcggctgacgcacgcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system