KEGG   Xanthomonas campestris pv. raphani: XCR_2456Help
Entry
XCR_2456          CDS       T01872                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00040  Pentose and glucuronate interconversions
xcp00052  Galactose metabolism
xcp00500  Starch and sucrose metabolism
xcp00520  Amino sugar and nucleotide sugar metabolism
xcp01100  Metabolic pathways
xcp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XCR_2456
   00052 Galactose metabolism
    XCR_2456
   00500 Starch and sucrose metabolism
    XCR_2456
   00520 Amino sugar and nucleotide sugar metabolism
    XCR_2456
Enzymes [BR:xcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XCR_2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEL07331
UniProt: G0CFL3
Position
complement(2567801..2568619)
Genome map
AA seq 272 aa AA seqDB search
MPKEMLPIIDKPLIQYAVDEAIQAGCDTLIFVTNRYKHSIADYFDKAYELEQKLERAGKL
EQLELVRHALPEGVRAIFVTQAEALGLGHAVLCAKAVVGDEPFAVLLPDDLMWNRGDAAL
TQMADVAEASGGSVIAVEDVPHDKTASYGIVSTDAFDGRKGRINAIVEKPKPEVAPSNLA
VVGRYVLSPKIFEYLESTGAGAGGEIQLTDAIAELLKQEQVDAFRFEGRRFDCGAHIGLI
EATVHFALEHDKHGAPAKEIIRSALAAADARG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaaggaaatgctgccgatcatcgataaaccgcttatccagtacgccgtggacgaa
gccatccaggccggttgcgatacgctgatcttcgtcaccaatcgctacaagcactcgatc
gccgactacttcgacaaggcctatgagctggagcagaagctcgagcgcgcaggcaagctc
gagcaactggagctggtgcgccatgcactccccgagggcgtccgcgccatttttgtgacg
caggccgaagcgctcggcctgggccacgcggtgctgtgtgccaaggccgtggtcggtgac
gaaccgttcgcagtgctgctgcccgacgacctgatgtggaaccgcggcgatgcggcgctg
acccagatggccgatgtggcggaagcctccggcggcagcgtgatcgccgtggaagatgtg
ccgcacgacaagacggccagttatggcatcgtgtccaccgatgcgttcgacggccgcaag
ggccgcatcaatgccatcgtcgaaaagcccaagccggaagtggcgccgagcaatctggca
gtcgtcggtcgttacgtgctcagcccgaagatcttcgagtacctggagtccacgggcgcc
ggtgcaggtggcgagatccagctcaccgatgcgatcgccgagctgctcaagcaggaacag
gtcgacgcgttccgtttcgagggccgtcgcttcgactgcggcgcgcacatcggtttgatc
gaggccacggtgcactttgcgctcgagcacgacaagcatggcgcaccggccaaggaaatc
attcgcagcgccttggctgcggctgacgcacgcggctga

DBGET integrated database retrieval system