KEGG   Xanthomonas campestris pv. raphani: XCR_2677Help
Entry
XCR_2677          CDS       T01872                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCR_2677
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XCR_2677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2819902..2821719)
Genome map
AA seq 605 aa AA seqDB search
MAYVGIGLVGVRRFGDHRGMTIFQTLLTAMVIASPIAACAADTTGTTGTTPAAGATIHVN
QLGYLPGSAKLAVVGLPASAAAGPDRFTVEDAKGARVLEGSLSPAASWAPAGQQARVADF
STLRTPGTYRLKIAGMPASDAFPIAASAYQPVVDASLKAFYYNRASTELPAQFAGRYARA
AGHPDTDVRIHPSAASATRPANSVISAPKGWYDAGDYNKYIVNSGISTYTLLAAYEHYPA
LFKAQALTIPNDAPGVPGILQEVWWNLEWMLAMQDPADGGVYHKLTDKQFDGLVMPDQAK
QQRYVVMKATAATLDFAAVMAAASRVYAPFDKQYPGASARMLKAARSAWAWAQQHPNVIY
RQPDDVRTGGYDDATVDDEFAWAAAELYVSTREDAFYDAMLARNVHASVPGWSNVGGLAW
MSLAAHRDQLTPHADRARIEGEISGLAQRLGDQWQASPWRLAMADNDFVWGSNAVVLNQA
MMLLQGYRVTQQRRYLDAAQSQLDYILGRNPLGLSFVTGVGQRTPMHIHHRPSEADGIDA
PVPGWLAGGPQPGQQDAKDCKVAYPSKLAALSYLDNTCSYATNEVAINWNAPLVYVSAAI
EASTR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
gtggcctatgtcgggattggacttgtcggtgtgcgtcgatttggcgaccatcgtggcatg
accattttccagaccctgctcaccgccatggtgatcgcatcgcccatcgccgcctgtgcg
gcggacacgaccggcactaccggcaccacgccggccgctggcgccaccatccacgtcaat
caactcggctatctgccgggctcggccaagctggcggtggtcggcttgccggcgtccgct
gcggccggtccagaccgcttcacggtggaggatgccaagggcgctcgcgtgctggagggc
agcttgtcgccggcggccagttgggcaccggcggggcaacaggcacgcgtggccgacttt
tccacactgcgcacgccgggtacgtatcggttgaagatcgccggcatgccggcctcggat
gcattcccgattgcagcgagtgcctaccagccggtcgtggatgcctcgctgaaggcgttc
tactacaaccgtgccagtaccgagttgccggcacaatttgccgggcgctacgcgcgcgcg
gccgggcatccggacaccgatgtgcgcatccatccgtcggcggcgtctgccacgcgcccg
gccaacagcgtgatcagcgcgcccaaggggtggtacgacgcgggcgactacaacaagtac
atcgtcaattccggcatcagcacctacaccttgctggccgcgtatgagcactacccggcg
ctgttcaaggcgcaggcactcaccattcccaacgatgcgcctggcgtgcccggcatcctg
caggaagtgtggtggaatctggaatggatgctggccatgcaggacccggccgatggcggg
gtgtaccacaagctcaccgacaagcagttcgatgggctggtgatgccggaccaggccaag
cagcagcgctatgtcgtgatgaaggccaccgccgccacgctggatttcgccgcggtgatg
gcggcggccagccgcgtgtatgcgccgttcgacaagcagtatccaggcgcgtcggcgcgc
atgttgaaggcggcgcgtagtgcctgggcgtgggcgcaacaacacccgaacgtgatctat
cgccagcctgacgacgtgcgtaccggcggctacgacgacgccaccgtagatgacgaattt
gcctgggcagcagcggagctctatgtgagcacgcgcgaggacgcgttctacgacgccatg
ctggcgcgcaacgtacatgccagcgtgccggggtggagcaacgtgggtggattggcctgg
atgtcgttggccgcccaccgtgaccagctcacgccgcatgccgaccgcgcacgtatcgaa
ggcgaaatcagcgggctggcgcagcgcctgggcgaccagtggcaggcatcgccgtggcgg
ttggccatggccgacaacgactttgtctggggcagcaatgcggtggtgctcaatcaggcc
atgatgctgctgcagggctaccgggtgacgcagcaacgtcgttatctggatgcggcgcaa
tcgcagctggactacatcctggggcgcaatccgctggggctgtcgttcgtcaccggggtc
gggcagcgcacgccaatgcatatccaccatcgcccatccgaagccgacggcatcgatgcg
cccgtgccgggctggctggccggtggcccgcagccgggccagcaggacgcgaaagactgc
aaggtggcgtatccgtccaagctggccgcgctgtcgtatctggacaacacctgcagctac
gcgacaaacgaggtggcgatcaactggaatgcgccgctggtgtatgtaagtgcggcgatc
gaggcgtcgacccgctga

DBGET integrated database retrieval system