KEGG   Xanthomonas campestris pv. raphani: XCR_2860Help
Entry
XCR_2860          CDS       T01872                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCR_2860 (tpiA)
   01230 Biosynthesis of amino acids
    XCR_2860 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_2860 (tpiA)
   00051 Fructose and mannose metabolism
    XCR_2860 (tpiA)
   00562 Inositol phosphate metabolism
    XCR_2860 (tpiA)
Enzymes [BR:xcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XCR_2860 (tpiA)
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XCR_2860 (tpiA)
  Exosomal proteins of bladder cancer cells
   XCR_2860 (tpiA)
  Exosomal proteins of melanoma cells
   XCR_2860 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3023522..3024277)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGTRAFATELVAQVAAHMPLAGVDVVILPPLPYLGDLIEDFEAHHLAF
GAQDVSSNEKGAYTGEVSASMLVDVGAEYGLVGHSERRQYHQESSELVARKFAAAMHAGL
IPVLCVGESLEQREAGQTEAILRAQLEPVLSLVGSTGFARAVVAYEPIWAIGTGRTATPD
QAQAVHAFIRGEVAKADARIADSLPILYGGSVKPDNASELFSQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgctggaaattggaagctgcatggcacgcgtgccttcgccacc
gaactggtggcgcaggtggccgcgcacatgcccctggcgggtgtcgatgtcgtcatcctg
ccgcccttgccgtatctcggtgatctgatcgaggacttcgaggcccaccacctggcattc
ggtgcacaggacgtcagtagcaacgagaagggcgcctacaccggtgaagtgtccgcctcg
atgctggtggatgtcggtgccgaatacggactggtcgggcattcggagcgccgtcagtat
caccaggaaagcagcgagctggtcgcgcgcaagtttgccgccgcaatgcatgccgggttg
atcccggtgctgtgcgttggcgaatcgctggaacagcgcgaggccggtcagactgaggca
atcctacgtgcccagttggagccggtcctgagtctggtcggcagcaccggattcgcccgc
gccgtagtggcctacgagccgatctgggccatcgggaccgggcgcaccgccacgccggac
caggcccaggccgtgcacgccttcattcgtggcgaagtcgcgaaggcggatgctagaatt
gccgattcactgcccatcctgtacggggggagtgtcaagcccgacaacgccagcgagctg
ttttcccagcccgacgtcgacggtgggctggtcggcggcgcgtcactggttgccgaagac
ttcctggccatcgcgcgtgcggcggccgcttgttaa

DBGET integrated database retrieval system