KEGG   Xanthomonas campestris pv. raphani: XCR_2860Help
Entry
XCR_2860          CDS       T01872                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00010  Glycolysis / Gluconeogenesis
xcp00051  Fructose and mannose metabolism
xcp00562  Inositol phosphate metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
xcp01200  Carbon metabolism
xcp01230  Biosynthesis of amino acids
Module
xcp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_2860 (tpiA)
   00051 Fructose and mannose metabolism
    XCR_2860 (tpiA)
   00562 Inositol phosphate metabolism
    XCR_2860 (tpiA)
Enzymes [BR:xcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XCR_2860 (tpiA)
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XCR_2860 (tpiA)
  Exosomal proteins of bladder cancer cells
   XCR_2860 (tpiA)
  Exosomal proteins of melanoma cells
   XCR_2860 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEL07726
UniProt: G0CJW5
Position
complement(3023522..3024277)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGTRAFATELVAQVAAHMPLAGVDVVILPPLPYLGDLIEDFEAHHLAF
GAQDVSSNEKGAYTGEVSASMLVDVGAEYGLVGHSERRQYHQESSELVARKFAAAMHAGL
IPVLCVGESLEQREAGQTEAILRAQLEPVLSLVGSTGFARAVVAYEPIWAIGTGRTATPD
QAQAVHAFIRGEVAKADARIADSLPILYGGSVKPDNASELFSQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgctggaaattggaagctgcatggcacgcgtgccttcgccacc
gaactggtggcgcaggtggccgcgcacatgcccctggcgggtgtcgatgtcgtcatcctg
ccgcccttgccgtatctcggtgatctgatcgaggacttcgaggcccaccacctggcattc
ggtgcacaggacgtcagtagcaacgagaagggcgcctacaccggtgaagtgtccgcctcg
atgctggtggatgtcggtgccgaatacggactggtcgggcattcggagcgccgtcagtat
caccaggaaagcagcgagctggtcgcgcgcaagtttgccgccgcaatgcatgccgggttg
atcccggtgctgtgcgttggcgaatcgctggaacagcgcgaggccggtcagactgaggca
atcctacgtgcccagttggagccggtcctgagtctggtcggcagcaccggattcgcccgc
gccgtagtggcctacgagccgatctgggccatcgggaccgggcgcaccgccacgccggac
caggcccaggccgtgcacgccttcattcgtggcgaagtcgcgaaggcggatgctagaatt
gccgattcactgcccatcctgtacggggggagtgtcaagcccgacaacgccagcgagctg
ttttcccagcccgacgtcgacggtgggctggtcggcggcgcgtcactggttgccgaagac
ttcctggccatcgcgcgtgcggcggccgcttgttaa

DBGET integrated database retrieval system