KEGG   Xanthomonas campestris pv. raphani: XCR_2875Help
Entry
XCR_2875          CDS       T01872                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCR_2875 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCR_2875 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCR_2875 (trpB)
Enzymes [BR:xcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XCR_2875 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3037323..3038540)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFHAYPDAAGHFGKFGGRFVAETLIAPLQELSAAYDLARQDPAFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMQLLGAKVIPVTSGSATLKDA
LNEAMRDWVSNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLEDYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIASGRHAASIAAGRPGVLHGNRTYVICD
DDGQIIETHSVSAGLDYPGVGPEHAFLSDSGRAVYQGITDDEALAAFHLLAHTEGILAAL
ESSHAVAQSIKLAREMPKDALVLCNLSGRGDKDVHTIAAREGMVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgactttcatgcgtatccggatgccgccggccatttcggc
aagtttggcggccgcttcgtcgcggaaaccttgattgcgcccctgcaggaactgtctgcc
gcctacgatctggcgcgccaggacccggccttcattgccgagtacgacaaggatctcaag
cattacgtcggtcgccccagtccgatctaccacgccgagcggctgagccgcgaagtgggc
ggggcgcaaatcctgctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggcgctgctggccagccgcatgggcaagacccgcatcatcgccgag
accggcgccggccagcatggcgtggccagtgccaccgtcgcggcgcggctgggcctggaa
tgcgtggtctacatgggcgcgaccgacatcgaacggcagaagatcaacgtctaccgcatg
cagttgctcggggccaaggtcatcccggtcacctcgggctcggccacgctcaaggacgcg
ctgaatgaagcgatgcgcgactgggtcagcaacgtgcaggacaccttctacatcatcggc
accgtcgccggcccggatccgtatccgcgcatggtgcgcgatttcaacgccatcgtcggc
cgcgaagcgcgtgcgcagatgctggaagactacggccgcctgccggatgcgatcagcgcc
tgcgtgggcggcggcagcaacgccatcggtttgttccatgcgttcttgaacgaccccggc
gtcaagatctacggcgccgaagcggcgggtgatggcattgccagcggccgccatgcggca
tcgatcgccgccgggcggcccggcgtgctgcacggcaatcgtacgtatgtgatctgcgat
gacgacggccagatcatcgagacccattcggtctcggcgggcctggactaccccggcgtg
ggaccggagcatgccttcctctccgacagcggccgtgccgtgtaccagggcatcaccgac
gacgaagcgctggccgcgttccacttgctggcgcataccgagggcatcctggccgcgctg
gaatccagccatgcggtcgcgcagtcgatcaagcttgcccgcgaaatgcccaaggacgcg
ctggtgctgtgcaacctgtccggccgtggcgacaaggacgtgcacaccatcgccgcgcgc
gaaggcatggtgctgtga

DBGET integrated database retrieval system