KEGG   Xanthomonas campestris pv. raphani: XCR_3071Help
Entry
XCR_3071          CDS       T01872                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00010  Glycolysis / Gluconeogenesis
xcp00260  Glycine, serine and threonine metabolism
xcp00680  Methane metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
xcp01130  Biosynthesis of antibiotics
xcp01200  Carbon metabolism
xcp01230  Biosynthesis of amino acids
Module
xcp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_3071
  Energy metabolism
   00680 Methane metabolism
    XCR_3071
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCR_3071
Enzymes [BR:xcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XCR_3071
Membrane trafficking [BR:xcp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    XCR_3071
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XCR_3071
  Exosomal proteins of melanoma cells
   XCR_3071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEL07936
UniProt: G0C9M3
Position
complement(3245636..3246385)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRQEAAAAGKLMKDEGLQFDVAYTSVLK
RAIHTLQGALKELDQDWLPVHKSWRLNERHYGGLQGLDKAETAAKHGEEQVKIWRRSYDI
PPPAMDVTDPGHPGHDRRYATLDRNALPGTESLATTLVRVLPYWHDAIAPQLKVGQTVLV
TAHGNSLRALYKYLNDISNEQILELNIPTGIPLLFELDDNLQVQSYRYLGDPEAAKRAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcaaactcgtactgctgcgccatggccagagccaatggaacctggacaaccgt
ttcaccggctgggtggacgtggatctcaccgagcagggccgccaggaagccgccgcggcc
ggcaagctgatgaaggacgaagggctgcagttcgatgtggcgtacacctcggtgctcaag
cgcgccatccacacgctgcagggcgcgctgaaggagctcgaccaggactggctgccggtg
cacaagagctggcgtctcaacgagcgtcactacggtggcctacagggtttggacaaggcc
gaaaccgcggccaagcacggcgaggaacaggtcaagatctggcgccgttcctacgacatc
ccgcccccggccatggacgtcaccgatccgggccaccccgggcatgaccgccgttacgcc
acgctggaccgcaatgcattgccgggcaccgagtcgctggcgaccacgctggtgcgcgtg
ttgccgtactggcacgacgcgatcgccccgcagttgaaggtcggccagacggtgctggtc
accgcgcacggcaactcgttgcgcgcgctgtacaagtacctcaacgacatttccaacgag
cagatcctggagctcaacattcccaccggcatcccgctgttgttcgagctggacgacaac
ctgcaggtgcagagctaccgctacctgggcgacccggaagcggccaagcgcgccgccgaa
gccgtggccaaccagggcaaggccaagtaa

DBGET integrated database retrieval system