KEGG   Xanthomonas campestris pv. raphani: XCR_3272Help
Entry
XCR_3272          CDS       T01872                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xcp00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xcp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3449831..3452287
Genome map
AA seq 818 aa AA seqDB search
MLSNTGPVPRMMSSRRLLSTRLPSRLLVCCVAVSALLGCGQREAGTAPAVASAGAPAAAA
ANTPLPLIPAPAQVTRGSGSFHIGAGTVISIVGGDADARRSAEYLAELLKRTRGLSLEVR
NETSASPGSIRLERSAQAPVAQKEGYSLDSDAKGLRIQARDGAGLFYGTVSAWQLMTPDA
RKGDVEVPAVAIRDWPRFSWRGQHLDVARHFHDVATVKHVLDTMAVHKLNVLHWHLTDDQ
GWRIEIKRYPKLTEVGAWRTPPGAGQHGTPERYGGFYTQEQISEVVAYAARLHITVLPEL
DMPGHAQAAVAAYPEEVGVPGVRTQVGVDWGVNPYLFNTSERSLSFITNVLDEVLTLFPS
TYIHIGGDEAVKDQWEASPAVRAQMRKLGVKDAHAMQGWFNEQLAQYLTQHGRRMIGWDE
ILEGGVPASAAVMSWRGVEGAVTAAKQGHDVVLAPGDSLYLDNLQTTRSDEPNGRLTTLP
LSKVYAFNPVPTALNAEQAKHVLGAQGALWAEYIPSRWHIDHALFPRLAAVAEVTWSPMA
ARDWKSFLARMPAQLQRYQALGIDYSDGAFAADIDLEGDVNAVLAGGPAKVSLGNQSGAG
SLHYTVDGSDPTPDAPRYTAPFAIQLPTTVKATAFTDDGIALAAPRSRTFDRAALLSRDT
QGLRHCVEQGALGLRLPLLPDLPGADTPVYNVDLFHACRLYPQARLDDVGAIKVDAARLA
RNFGLAHEQSKVQKYPAKTPGGELEVRLGCEGELLARIPLPKGNALGEQFTLESALPARP
GTHDLCLRFTAPITGPLYAIGAVHLIETTAQAPPAATR
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgctctccaacaccggccctgttccacgcatgatgtcgtcgcgacggctgctgtccaca
cgattgccgtcgcgcctgcttgtctgctgcgttgcagtcagcgccctgcttggatgtggt
caacgcgaggccggcaccgcaccggccgttgccagtgccggcgcccccgcggcagctgcc
gccaacacaccgctgcccctgattccggcaccggcgcaggtcacacgcggcagtggcagt
ttccacatcggtgccggcacggtgatttcgatcgtcggtggcgatgccgatgcacgccgc
agcgccgaatatctcgccgagctgctcaagcgcacgcgcggcctctcgctggaagtgcgc
aacgaaaccagcgcatcgccgggcagcatccgcctggaacgcagcgcgcaggcaccggta
gcgcagaaggaaggctatagcctggatagcgacgcgaagggcctccgcatccaggcgcgt
gatggcgccgggttgttctacggcaccgtgagcgcgtggcagttgatgaccccggatgcg
cgcaagggcgatgtcgaggtaccagcggtggccatccgcgactggccgcgtttcagctgg
cgcggccagcatctggatgtggcgcgccacttccacgacgtggcaacggtcaagcacgtg
ctcgacacgatggccgtgcacaagctcaacgtgctgcactggcatctcaccgatgaccag
ggctggcggatcgagatcaagcgctatcccaagctcaccgaggtgggtgcgtggcgcacg
ccgccgggcgcgggccagcacggcacaccggagcgctatggcggcttctacacgcaggaa
cagatcagcgaagtggtggcctacgcggcgcgcctgcacatcaccgtgctgcccgagctg
gatatgcccgggcatgcgcaggcggccgttgccgcctaccccgaagaggtgggcgttccc
ggcgtgcgcacccaggtgggtgtggactggggcgtcaatccgtacctcttcaacaccagc
gagcgcagcctgagcttcatcaccaatgtgctggatgaagtgctcacgctgtttccgtcg
acctacatccacatcggcggcgatgaggcagtcaaggaccaatgggaagcctcgccggcc
gttcgcgcacagatgcgcaagctcggcgtcaaggacgcacacgcgatgcaaggctggttc
aacgaacagctggcccagtacctcacccaacacggccggcgcatgatcggctgggacgaa
atcctcgaaggcggcgtgccggccagcgcggccgtgatgtcctggcgtggcgtcgaaggc
gcggtgaccgccgccaagcaaggccacgacgtggtactggcaccgggcgattcgctgtat
ctggacaacctgcaaaccacgcgcagcgatgaacccaacggccgcctgaccacgctaccg
ctctcgaaggtctacgcattcaacccggtgccgaccgcgctcaatgccgaacaggccaag
catgtgctcggcgcacagggcgcgttgtgggccgaatacattccctcgcgctggcacatc
gaccacgcgctgttcccgcgcctggcagcggtggccgaagtgacgtggtcgccgatggcc
gcgcgcgactggaagagtttcctggcgcgcatgccggcgcagctgcagcgttatcaggcg
ctgggcatcgattacagcgatggcgcctttgccgccgacatcgacctggagggcgacgtc
aacgcggtactggccggtggcccggccaaggtgtcgctcggcaaccagagcggcgccggc
agcctgcactacaccgtggatggcagcgaccccacgccggatgcaccgcgctacacggcg
ccgttcgcgattcagctgcccaccaccgtcaaggccaccgccttcaccgacgatggcatc
gcactggccgccccgcgcagccgcacctttgaccgtgccgcgctgctgagccgcgacacc
cagggtctgcgtcactgtgtcgagcaaggagcgctgggcttgcgcctgccgctgctgccg
gatctgccgggcgcggacacgccggtctacaacgtggacctgttccatgcctgccgcctg
tatccgcaggcgcggctggatgatgtaggcgcgatcaaggtggacgccgcacgcctggcg
cgcaacttcggcctggcgcacgagcagtccaaggtgcagaagtacccggccaagacaccc
ggcggtgaactcgaagtgcgcctgggttgcgaaggcgagctgctcgcgcgcatcccgctg
cccaagggcaacgcgctcggcgaacaattcacgctggaaagcgcgctgcctgcacgcccc
ggcacgcacgatctgtgcctgcgcttcaccgcccccatcaccggcccgttgtatgccatc
ggtgccgtccatctgatcgaaaccaccgcgcaggcgccccccgccgccacgcgctga

DBGET integrated database retrieval system