KEGG   Xanthomonas campestris pv. raphani: XCR_3277Help
Entry
XCR_3277          CDS       T01872                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XCR_3277
Enzymes [BR:xcp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XCR_3277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3462213..3464054
Genome map
AA seq 613 aa AA seqDB search
MLRTTLAPLVLALAIALPITATAASDDQWPTFATQGTQFVRDGKPYQVLSGAIHFQRIPR
AYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFNANNDVAAFVREAAAQGLNVILRP
GPYACAEWEAGGYPAWLFGKDNIRVRSRDPRFLAASQSYLDAVAQQVRPLLNHNGGPIIA
VQVENEYGSYDDDHAYMADNRAMFVKAGFDKALLFTSDGADMLANGTLPGTLAVVNFAPG
EAKSAFDKLIKFQPDQPRMVGEYWAGWFDHWGTPHASTNAKQQTEELEWILRQGHSANLY
MFIGGTSFGFMNGANFQGNPSDHYAPQTTSYDYDAILDEAGRPTPKFALMRDVITRVTGV
QPPALPAPIAMAALKDAPLRESASLWDNLPAPIAIATPQPMEHFGQDYGYILYRTTVTGP
RKGSLYLGEVRDVARVYVNQQPVGSVERRLQQVATEVDIPAGQHTLDVLVENSGRINYGP
RMADGRAGLVDPVLLDNQPLTNWQAFPLPMRSPDSIRGWTGKPVQGPAFHRGTLRIGTPA
DTYLDMRAFGKGIAWANGVNLGRHWNIGPQRALYYPAPFQRKGDNTVVVFDLDSTPKPSV
RGLQQQVWMTPKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtaccacgcttgccccgctcgttctggccctggccatcgcactgcccatcacc
gccacggccgccagcgatgaccagtggcccaccttcgccacccagggcacgcagttcgtg
cgcgacggcaagccgtaccaagtgctttccggtgccatccatttccagcgcattccgcgc
gcctactggaaagaccgcctgcaaaaagcgcgtgcgctgggcttgaacacggtggaaacc
tacgtgttctggaatctggtcgaaccgcagcaggggcaattcgatttcaacgccaacaac
gacgtggccgcgttcgtacgcgaggccgccgcgcaaggcctcaacgtgatcctgcggccg
ggcccgtacgcctgcgcggaatgggaagccggtgggtatccagcctggttgttcggcaag
gacaacatccgcgtacgcagccgcgacccgcgctttctcgccgccagccagtcctacctg
gatgcagtcgcgcagcaggtgcgcccactgctcaaccacaacggcggcccgatcatcgcc
gtgcaggtggaaaacgaatacggctcctacgacgacgaccatgcctacatggccgacaac
cgcgccatgttcgtcaaggccggcttcgataaggcgctgctgtttacctccgacggcgca
gacatgcttgccaacggcaccctgccgggtacgttggccgtggtgaatttcgccccgggc
gaggccaagagtgcgttcgacaaactgatcaagtttcagcctgaccaaccgcgcatggtc
ggcgaatactgggccggctggttcgaccattggggtacgccgcacgccagcaccaacgcc
aagcagcagaccgaggaactggaatggatcctgcgccagggccattccgccaacctctac
atgttcatcggcggcaccagtttcggcttcatgaatggtgccaatttccagggcaatccc
agcgaccattacgcaccacagaccaccagctacgactacgacgccatcctggacgaagcc
ggccgccccacgcccaagttcgcgctgatgcgcgatgtcatcacgcgcgtcaccggcgtg
cagccgccggccttgccggcaccgatcgccatggccgcgctgaaagacgcaccgctgcgc
gaatcggcctcgctgtgggacaacctgcccgcgcccatcgccatcgccacgccgcagccg
atggaacatttcggccaggattatggctacatcctgtatcgcaccaccgtcaccggccca
cgcaagggttcgctgtatctgggcgaggtgcgcgacgtagcacgcgtctatgtgaatcag
cagcccgttggcagcgtcgaacgccggctgcagcaggtcgccaccgaggtggacattccg
gctggccaacacaccctggatgttctggtcgaaaacagcggccgcatcaactacggcccc
cgcatggccgacggccgcgccggcctggtcgacccggtactgctggacaaccaaccgctg
accaactggcaggccttcccgctccccatgcgctcgcccgacagcatccgtggctggacc
ggcaagcccgtgcaaggccccgccttccatcgcggcaccctgcgcatcggcacgccggcc
gacacctacctggacatgcgcgcattcggcaaaggcatcgcctgggccaacggcgtcaac
ctcggcaggcactggaacatcggcccgcaacgggcgctgtattaccccgccccgttccag
cgcaagggcgacaacaccgtggtggtgttcgacctggacagcacccccaagcccagcgtg
cgcggcctgcagcagcaggtatggatgacgccgaaggagtga

DBGET integrated database retrieval system