KEGG   Xanthomonas campestris pv. raphani: XCR_3438Help
Entry
XCR_3438          CDS       T01872                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCR_3438
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XCR_3438
   00640 Propanoate metabolism
    XCR_3438
   00660 C5-Branched dibasic acid metabolism
    XCR_3438
Enzymes [BR:xcp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XCR_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3643425..3644594)
Genome map
AA seq 389 aa AA seqDB search
MNFHEYQSKQLLAEYGIPVPAGKVASTPDEAVEVANSLGKGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAADKMLGTKMSTYQTAGVELPVNLVLVTTAGEIVKELYLSILVDRGTKT
ITYIVSSEGGVEIEQVAAETPELIHSLNVDFVEGVQGYHGRDFGFKLGLNAKQAGQFASI
MVNLYRLFNDKDLALVEINPLAILDDGNLYALDGKFDSDDNAAFRQKALVAMRDKTQEDE
TEVTASELDINYVTMDGNIGCMVNGAGLAMATMDVIKLNGGEPANFLDVGGGANKQRVIE
AFKLILSSDKVEGIFVNIFGGIVRCDMIAEGIIAAVKEVGVKVPVVVRLEGTNVEEGKQL
LRDSGMAIIPADNINDGAKKVVEAVKNAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccagtcaaaacagctgcttgccgagtacggcatccccgtcccg
gccggtaaggtcgcgtccacgccggacgaagcggttgaagtcgccaactccttgggcaag
ggcccctggatggtcaaggcgcagatccacgcgggcggccgcggcaaggctggcggcgtc
aagttctgcaagaccaccgacgacgtgaaggccgcagcagacaagatgctcggcaccaag
atgtccacctaccagaccgcaggcgtcgagttgccggtcaacctggtgctggtgaccacc
gccggcgagatcgtcaaggagctgtacctgtcgatcctggtcgaccgcggcaccaagacc
atcacctatatcgtttccagcgagggtggcgtggagatcgagcaggtcgccgccgagacg
ccggagctgatccactcgctcaacgtcgatttcgtcgaaggcgtgcagggctaccacggc
cgcgatttcggcttcaagctcggcctcaatgccaagcaggccggccagttcgccagcatc
atggtgaacctgtatcgcctgttcaacgacaaggacctggcgctggttgaaatcaacccg
ctggcgatcctggacgacggcaacctgtatgcgctggacggcaagttcgacagcgacgac
aacgccgcattccgtcagaaggcgctggtcgccatgcgcgacaagacccaggaagacgag
accgaagtgaccgcttcggagctggacatcaactacgtcaccatggacggcaacatcggt
tgcatggtcaacggcgccggcttggccatggccaccatggacgtcatcaagctcaacggc
ggcgagccggcgaacttcctggacgtgggcggcggtgccaacaagcagcgcgtcatcgaa
gcgttcaagctgatcctgtcctcggacaaggtcgaaggcatcttcgtcaacatcttcggc
ggcatcgtccgctgcgacatgatcgccgaaggcatcattgccgcggtcaaggaagtgggc
gtcaaggtgccggtcgtggtgcgcctggaaggcaccaacgtggaagagggcaagcagctg
ctgcgtgacagcggcatggccatcatcccggccgacaacatcaacgacggcgccaagaag
gtcgttgaagctgtcaagaacgctgcctga

DBGET integrated database retrieval system