KEGG   Xanthomonas campestris pv. raphani: XCR_3668Help
Entry
XCR_3668          CDS       T01872                                 

Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xcp  Xanthomonas campestris pv. raphani
Brite
Enzymes [BR:xcp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XCR_3668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3914702..3915358
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVEIPLSAGH
KMMKPVVEGRMLQALDLQPGEDVLEVGTGSGFSTACLAALAREVVSLEIDPALAAAARAN
LDATGLGSNVRIETADVFAWQSERRFDAICVTGAVDTLPTQWLQWLRPNGRLFVVRGHDP
VMEAVLVRGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggtcgaacagcagatccggccgtgg
gatgtgctggacctgcgcgtgctcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcctacaagaccctggcctacgtcgatgtggaaattccgctgtcggccggccac
aagatgatgaagccggtggtcgaaggccgcatgttgcaggccctggatctgcagcccggc
gaagacgtgctggaagtgggcaccggcagcggcttctccaccgcctgcctggccgcgctg
gcccgcgaagtggtgagcctggagatcgaccccgcgctggctgccgccgcgcgtgccaac
ctggacgccaccggcctgggcagcaacgtgcgtatcgaaaccgccgacgtgttcgcctgg
cagagcgagcgtcgcttcgacgccatctgcgtgaccggcgcggtcgatacgctgccgacc
cagtggctgcagtggctgcgcccgaacggccggctgtttgtggtgcgcggtcacgatccg
gtgatggaggccgtcctggtccgtggtgacgtcaacgcgccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggcgccgcaccgacgccccgattccaattctga

DBGET integrated database retrieval system