KEGG   Xanthomonas campestris pv. raphani: XCR_3773Help
Entry
XCR_3773          CDS       T01872                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xcp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4033588..4034109)
Genome map
AA seq 173 aa AA seqDB search
MREYRMTTVLLSLGSNVQPTHYLRLAVEALRARFGPIDVSPAYRTAAVGFDGPDFVNNGV
QLQTDWELQALDDWLHALEDRHGRDRSGPRFSDRTLDVDVVFFGDRIVEGPGHLRVPRPE
LKHAFVLKPLADIAPAFVDPLSGKTLAALWQAHPQYGSAFTTVELDNAVALPQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatatcgcatgaccaccgtgctcctcagcctgggcagtaacgtccagccaacc
cattacctgcgtctggccgtcgaggccttgcgcgcgcgttttggcccgatcgacgtctcg
ccggcgtatcgcaccgcggcggttggtttcgatggccctgacttcgtcaacaacggcgtg
caactgcagaccgattgggagctgcaggcgctggacgactggttgcatgcgctggaagac
cgccatggccgcgatcgcagcgggccgcgtttcagcgaccgcacgctggatgtggacgtg
gtgtttttcggcgaccgcatcgtggaagggccgggccatctgcgcgtgccacggcccgag
ctcaagcatgcgttcgtgctcaagccgttggctgacattgcgccggcattcgtcgacccg
ctgagcggcaagaccctggcggcgttgtggcaggcgcatccgcaatacggcagcgcgttc
accacggtggaactggacaacgcggtggcattgccgcagtaa

DBGET integrated database retrieval system