KEGG   Xanthomonas campestris pv. raphani: XCR_3773Help
Entry
XCR_3773          CDS       T01872                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XCR_3773 (folK)
Enzymes [BR:xcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     XCR_3773 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4033588..4034109)
Genome map
AA seq 173 aa AA seqDB search
MREYRMTTVLLSLGSNVQPTHYLRLAVEALRARFGPIDVSPAYRTAAVGFDGPDFVNNGV
QLQTDWELQALDDWLHALEDRHGRDRSGPRFSDRTLDVDVVFFGDRIVEGPGHLRVPRPE
LKHAFVLKPLADIAPAFVDPLSGKTLAALWQAHPQYGSAFTTVELDNAVALPQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatatcgcatgaccaccgtgctcctcagcctgggcagtaacgtccagccaacc
cattacctgcgtctggccgtcgaggccttgcgcgcgcgttttggcccgatcgacgtctcg
ccggcgtatcgcaccgcggcggttggtttcgatggccctgacttcgtcaacaacggcgtg
caactgcagaccgattgggagctgcaggcgctggacgactggttgcatgcgctggaagac
cgccatggccgcgatcgcagcgggccgcgtttcagcgaccgcacgctggatgtggacgtg
gtgtttttcggcgaccgcatcgtggaagggccgggccatctgcgcgtgccacggcccgag
ctcaagcatgcgttcgtgctcaagccgttggctgacattgcgccggcattcgtcgacccg
ctgagcggcaagaccctggcggcgttgtggcaggcgcatccgcaatacggcagcgcgttc
accacggtggaactggacaacgcggtggcattgccgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system