KEGG   Xanthomonas campestris pv. raphani: XCR_4042Help
Entry
XCR_4042          CDS       T01872                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01130  Biosynthesis of antibiotics
xcp01230  Biosynthesis of amino acids
Module
xcp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCR_4042 (trpC)
Enzymes [BR:xcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XCR_4042 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEL08899
UniProt: G0CJ39
Position
complement(4329182..4329979)
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEIAERSARVPLAELVARSADLPLTRGFAAAMKASIAAGEPAVIAEV
KKASPSKGVIRPDFHPADIAVSYEFGGASCLSVLTDVDFFQGSDAYLQQAREACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDHQLADLSGLAMQLGLDVLVEVHDIDELERA
VQVPVPLVGINNRNLRTFEVSLQTTLDMRAAVPRDRVLVTESGIVTASDVQLMRSNGVNA
FLVGETFMRAPEPGEALRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattctcaataccatccttgcccgcaaggccgacgaaatcgccgagcgcagt
gcacgcgtgccgctggccgagctggtcgcgcgtagcgcagacttgccgctcacccgcgga
tttgccgccgccatgaaggccagcattgccgccggcgagccagccgtgattgccgaagtg
aagaaggccagcccgtccaagggcgtgatccggcccgacttccacccggccgacatcgcg
gtcagctacgagttcggtggtgccagctgcctgtcggtgctgaccgacgtggatttcttc
cagggctccgatgcgtatctgcagcaggcacgcgaggcctgcaccttgccggtgctgcgc
aaggatttcaccgtcgatccgtaccaggtctacgaggcgcgcgtgctgggcgccgactgc
atcctgctgatcgtctcggcgctggaggaccaccaactggccgacctgtccggtctggcg
atgcagttgggcctggatgtgctggtggaagtgcacgatatcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgctggtgggcatcaacaaccgcaatctgcgcaccttcgaggtg
tcgctgcagaccaccctggacatgcgtgcggctgtgccgcgtgatcgcgttctggtcact
gaaagcggcatcgtcaccgcatccgacgtgcagttgatgcgcagcaacggcgtgaacgcg
tttctggtcggcgagaccttcatgcgcgcgcccgaacccggcgaagcactgcgtcagcta
ttcttcgcgcatgactga

DBGET integrated database retrieval system