KEGG   Xanthomonas campestris pv. raphani: XCR_4101Help
Entry
XCR_4101          CDS       T01872                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4394249..4396180)
Genome map
AA seq 643 aa AA seqDB search
MSTQELHALAAAAGVMVDWVDASDQPRQVAPESIHAVLTALELPAASAAQRADSLQRIRA
TAAEPAPLVTVKVGEPLPLRVAPNAQGRWQAEDGSSEAAQADAQGRLLAPARFGYWTLEL
GTTAQQVAVAPQRCFSVADACGQPVPRAWGMALQVYSARSADDGGIGDAAGAMEWVRQAA
GANADALALSPVHASRPITGGYSPYSPSDRRFLDPLHAAPVCVLGDAVHTAIAAVPGLRE
RLDGLHGTALIDWPASAAAKWELLRQLSTQVTPDHPELAAFRAQGGAALEAFAHFAARDF
GDGDAHLHVFTQWLAARSWADVQREAHERGMRIGLIADLAVGFDPNGAEAAAAADTVLRG
LVLGAPPDAFNADGQHWGIGAYSPTALRRSGFAPYIALLRAVLRDRGGIRIDHILGLLRL
WVVPDGASSGDGAYLAYPLQDLLNLLALESWRHRAVVIGEDLGVVPPGIREELSRRGVMG
IDVLMFTRDQEGAFVPPALWRADAVATTTTHDLPTLTGWRAGRDIDWRRKLELIQPAQAQ
ADHQTRTRDASRLDAAVAEAGLGRDAPLLDALRFTASSVSPLALLPVEDALALDEQPNLP
GTVEVHPNWRRRLPDPLPQAQLTAALQGFAEARRVSAVSEPHP
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaggaactgcatgccctggccgccgcggccggggtgatggtggattgggtg
gacgccagcgaccagccgcgccaggtggcgccggagtcgatccatgccgtgctcaccgcg
ctggaattgcccgccgccagcgccgcgcagcgcgccgacagcctgcagcgcatccgcgcc
actgccgccgagccggcgccgctggtgacggtgaaggtgggcgagcccttgccgttgcgg
gttgcgcccaacgcacagggccgctggcaggccgaagacggcagcagcgaggccgcgcag
gccgatgcgcagggccggctgctggcgccggcgcgctttggctactggacgctggaactg
ggcaccacggcccagcaggtggccgtggcgccgcagcgctgcttcagcgtggccgacgcc
tgtggccagccggtgccgcgtgcgtggggcatggcgctgcaggtgtattcggcccgcagc
gccgacgatggcggcattggcgatgcggccggagccatggagtgggtgcggcaggccgcc
ggcgccaatgccgatgcgttggcgctgagcccggtgcatgcctcgcgcccgatcaccggc
ggctacagcccgtattcgcccagcgaccggcggttcctggaccccttgcatgccgcaccg
gtgtgcgtgctgggcgatgccgtgcacactgcgattgctgccgtgcccggcctgcgcgag
cgcctggacgggctgcatggcaccgcattgatcgactggccggcctcggccgctgccaag
tgggaactgctgcgccagctgtccacccaggtgacgccggaccacccggagctggcggcg
tttcgcgcccagggtggcgcggcgctggaggcgtttgcgcacttcgccgcgcgcgatttc
ggcgatggcgatgcgcacctgcatgtgttcacccaatggctggccgcccgcagctgggcc
gacgtgcaacgtgaagcgcacgagcgcggcatgcggatcggcctgatcgccgacctggcg
gtgggctttgatccgaacggtgccgaggccgccgccgcggccgacaccgtactgcgcggg
ctggtgctgggcgcgccgccggacgccttcaatgccgatggccagcactggggcatcggt
gcgtactcgcccaccgcgctgcgccgtagcgggtttgcgccgtatatcgcgctgctgcgt
gcggtgctgcgcgaccgcggcggtatccgcatcgatcacatcctgggcctgctgcggctg
tgggtggtgcccgatggcgccagctccggcgatggcgcctacctggcgtatccgctgcag
gacctgctcaatctgctcgcgctggaatcctggcggcatcgcgccgtcgtgattggcgaa
gacctgggcgtggtgccgccgggcatccgcgaagagctctcgcgccgcggcgtgatgggc
atcgacgtgctgatgttcacccgcgaccaggagggtgccttcgtgccgccggcgctgtgg
cgtgcggacgcggtggccaccaccaccactcacgatctgcccaccctgaccggctggcgc
gccggccgcgacatcgactggcgccgcaagctcgagctgatccagcccgcgcaggcgcag
gccgaccaccagacgcgcacgcgcgacgcttcgcgcctggacgcggccgtggccgaggcc
ggcctgggcagagatgcgccgttgctggatgcgctgcgcttcaccgccagcagtgtgtcg
ccgctggccctgctgccggtggaagacgcgctggcgctggacgaacaacccaatctgccg
ggcaccgtcgaggtccatcccaattggcgccgacgcctgcccgaccccttgccccaggcg
cagctgaccgccgcgctgcagggttttgccgaggcgcgccgcgtctcggccgtttcggaa
ccgcatccatga

DBGET integrated database retrieval system