KEGG   Xanthomonas campestris pv. raphani: XCR_4157Help
Entry
XCR_4157          CDS       T01872                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    XCR_4157 (glpK)
Enzymes [BR:xcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     XCR_4157 (glpK)
Exosome [BR:xcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCR_4157 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4461308..4462807
Genome map
AA seq 499 aa AA seqDB search
MEKKYVLAIDQGTTSSRAMLFDRQGKVAGVAQREFGQIFPQPGWVEHNPREIMTSVYTTI
TELLNNAQIDAREISGIGITNQRETAVVWDKATGQPIYNAIVWQSRQTKDICTQLKEAGH
EQMVRDKTGLLIDAYFSGTKVKWILDHVEGARERARKGELAFGTIDSWLIWNLTGGKVHV
TDYTNASRTMMYNIHTLEWDAELLEMLDVPAQMLPEVRSSSEVYGMTQTQYFYGEQVPIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMNTGDKAVASKAGLLTTIAWGIDGKVEY
ALEGAIFVAGSVVQWLRDGLRMFGKASDSQAYAERAGDNDGVYFVPAFVGLGAPYWRSDI
RGAVFGLTRGTSKEHFVRAAVESMAYQTRDVLTAMQSDSGIELKELRADGGAIANDFMAQ
FQSDILNVPVLRPEVAETTALGAAYLAGLATGFWSSREEIAKQWAVDRRFEPNMPEERRE
QLYAGWQQAVEATMGFRIS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatacgtccttgcgatcgaccagggcaccaccagctcgcgcgcgatgttg
ttcgatcgccagggcaaggtggccggcgtggcgcagcgcgaattcggccagatctttccg
caaccgggctgggtggaacacaacccgcgcgagatcatgaccagcgtctacaccaccatt
accgagctgctcaacaacgcgcagatcgacgcgcgcgagatctcaggcatcggcatcacc
aaccagcgcgagaccgcggtggtgtgggacaaggccaccggccagccgatctacaacgcc
atcgtctggcaatcgcggcagaccaaggacatctgcacccagctcaaagaggccggccat
gagcagatggtgcgcgacaagaccgggctgctgatcgatgcgtatttttccggcaccaag
gtcaagtggatcctcgaccacgtggagggcgcacgcgaacgcgcacgcaagggcgagctc
gccttcggcaccatcgatagctggctgatctggaacctcaccggcggcaaggtgcacgtg
accgactacaccaatgcctcgcgcaccatgatgtacaacatccacaccctggagtgggat
gccgagctgctggagatgctggacgtgcccgcgcagatgctgccggaagtgcgctcttcc
agcgaggtctatggcatgacccagacccagtacttctacggcgaacaggtgcccattgcc
ggcattgccggcgaccagcaggccgcattgttcgggcaagcgtgctttgaaccgggcatg
gcgaagaacacctatggcaccggctgtttcatgctgatgaataccggcgacaaggccgtg
gcctccaaggccggcttgctgaccaccatcgcctggggcatcgacggcaaggtggaatac
gcactggaaggcgccatcttcgtggctggctcggtggtgcagtggctgcgcgatgggctg
cgcatgttcggcaaggcgagcgattcgcaagcctatgcggagcgtgccggcgacaacgac
ggcgtgtatttcgtcccggccttcgtgggcctgggcgcgccgtactggcgcagcgatatc
cgcggtgcggtgttcggcctgacccgcggcaccagcaaggaacacttcgtgcgcgcggcg
gtggaatcgatggcctaccagacccgcgatgtgctcaccgcgatgcagagcgattcgggg
atcgaactgaaggagctgcgcgccgacggtggcgcgatcgccaacgacttcatggcgcag
ttccagagcgacattctcaacgtgccggtgctgcgtccggaggtggccgaaaccaccgcg
ctgggcgcggcctacctggcgggcctggccaccgggttctggagcagccgcgaagaaatc
gccaaacaatgggcggtggatcgccgcttcgagccgaacatgcccgaagagcggcgcgaa
cagttgtatgccggctggcagcaggcagtggaagccaccatgggcttccgcatcagctaa

DBGET integrated database retrieval system