KEGG   Xanthomonas campestris pv. raphani: XCR_4275Help
Entry
XCR_4275          CDS       T01872                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCR_4275 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XCR_4275 (aceA)
Enzymes [BR:xcp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XCR_4275 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4583111..4584406)
Genome map
AA seq 431 aa AA seqDB search
MSTPLQTAEQIQHDWATHPRWAGITRTYSAADVVRLRGTVHVEHSLARLGADKLWTSLHA
TPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGDDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDD
NDRGFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADVIWCETGKPDLEFARAFAQAIHA
KFPGKLLAYNCSPSFNWKKNLDDATIARFQTELASYGYKFQFITLAGFHALNYGMFHLAH
GYARSQMSAFVELQQAEFAAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEAQFHGEKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccgctgcagaccgccgaacagattcagcatgactgggccacccacccgcgc
tgggctggcatcacccgcacttacagcgccgccgatgtggtgcgcctgcgcggcaccgtg
cacgtcgagcattcgctggcacggctgggcgcggacaaactctggacatcgctgcatgcc
acgcccttcgtcaacgccttgggcgcgctcaccggcaaccaggcgatgcagcaggtcaag
gccggcctgaaggcgatctatctttccggttggcaggtggcggccgacgccaatctggcc
gggcagatgtatccggaccaatcgctgtacccggccgattcagtgccggcggtggtcaag
cgcatcaacaacaccttgctgcgcgccgatcagttgcaccatgccgaaggcgatgatgcg
atcgacttcctgcagccgatcgtggccgatgccgaagccggtttcggtggcgtgctcaat
gccttcgaactgatgaaggcgatgatcgaagctggcgcagccggcgtgcatttcgaggac
cagttggcctcggtgaaaaaatgcggacacatgggtggcaaggtgttggtgcccacccgc
gaggcgatcgagaaattgaatgccgcgcggctggctgccgatgtgctgggcgtgcccacc
gtcttgattgcacgcaccgacgccgaagccgccgacctgatcaccagcgacgtggacgac
aacgaccgcggtttcaccaccggcgagcgcactgtggaaggcttcttcaagacccgcaac
ggcctggaccaggccatcagccgcggcctggcctatgcgccgtacgcggatgtgatctgg
tgcgaaaccggcaagccggacctggaatttgcccgcgcctttgcgcaagccatccatgcc
aagttccccggcaagctgctggcctacaactgctcgcccagcttcaactggaagaagaac
ctggacgacgccaccatcgccaggttccagaccgaactggccagctatggctacaagttc
cagttcatcaccctggccggcttccacgcgctgaattacggtatgttccacctcgcccat
ggctatgcgcgcagccagatgagtgcctttgtcgagctgcagcaagccgagttcgcggcc
gcagagcgtggcttcactgcggtcaagcaccagcgtgaagtgggcaccggctacttcgat
gcagtgacgcaggcgatccagcagggacagtcctcgaccaccgcgttgcgtggctccacc
gaagaagcacagtttcacggcgagaaggcggcttag

DBGET integrated database retrieval system