KEGG   Xanthomonas campestris pv. raphani: XCR_4276Help
Entry
XCR_4276          CDS       T01872                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCR_4276 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCR_4276 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    XCR_4276 (aceB)
Enzymes [BR:xcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XCR_4276 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4584582..4586204)
Genome map
AA seq 540 aa AA seqDB search
MSATAASARPAAADRATPGVSLTTQLAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRR
SRQAAFDAGQLPDFRTDTRAIRAGDWRVAELPAALQDRRVEITGPTDPKMVINALNSGAK
VFMADFEDSTAPTWRNLLTGQRTLAAAVRGELTFDAPNGKHYALRPEHERAVLIVRPRGW
HLDEKHVLIDGQPMAGGLFDAALFAFHNARTLMAKDRGPYLYLPKLQSMEEAALWETALA
HIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRARIVGLNCGRWDYIFSYLKTFRAH
PDRVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARV
RADKLREVSAGHDGTWVAHPALIAVAMAVFDEHMPTAHQHHVLRNDVQVTSDMLVATPPG
GITRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRAQLWQWLHHGRHLDDG
TAIDQHLLDTTLRQLPARLGTTAGMPGGARIAEAIGLLDQLSRAEELADFLTVPAYRLID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccgccgcttccgcccgtcccgccgccgctgaccgtgccacccccggcgtg
tcgctgaccacccagctggcgggccaggccgagctgctccccgctgccgcgctggctttg
ctggtgtcgctgcaccgggcgatcgagcccggccgccagcagcggctggcgcagcgtcgc
agccgtcaggccgcgttcgacgccggccagttgcccgacttccgcaccgacacccgcgcc
atccgcgccggcgactggcgcgtggccgaactgccggccgccctgcaggaccgccgggtc
gagatcaccggccccaccgatccgaagatggtcatcaacgcgctgaactccggcgccaag
gtgttcatggccgacttcgaagattccaccgcgcctacctggcgcaacctgctgaccggg
cagcgcacgttggcggccgcggtgcgcggcgagctcacattcgatgcgcccaacggcaag
cactacgcgctgcgtccggaacacgaacgtgcggtgctgatcgtgcgcccgcgtggctgg
cacctggacgagaagcacgtgttgatcgatggccagccgatggccggcggcttgttcgat
gcggcgctgttcgccttccacaacgcacgtacgctgatggccaaggaccgcggcccgtac
ctgtatctgcccaagttgcagagcatggaagaagccgcgctgtgggagaccgcgctggcg
catatcgaagcgatgctcggcctgccgcacgggcagatcaaggtcaccgtgctgatcgaa
acgctgccggcggtgttcgagatggacgagatcctgcacgccttgcgcgcacgcatcgtc
gggctcaattgcggccgttgggattacatcttttcgtacctgaaaacctttcgcgcacat
ccggaccgcgtgttgcccgagcgtggccaggtcaccatgacccagccgtttctcaaggcg
tattcggaactgctgatcaagacctgccatcgtcgcggcgcgcatgcgatgggcggcatg
gccgcgcagattccaatcaaccacgacgaggccgccaacgaacaggccatggcgcgtgtg
cgtgccgacaagctgcgcgaggtcagcgccggccatgacggcacctgggtggcgcacccg
gcactgattgcggtggcgatggcggtgttcgacgagcacatgcccaccgcgcatcaacac
catgtgctgcgtaacgatgtgcaggtgacctccgacatgttggttgccacaccgcccggc
ggcatcacccgcgccggtttcgagggcaatgtcgaggtctgcgtgcgttacctggccgcg
tggctggacggcaatggctgcgtgcccatccataacctgatggaagatgcggccactgcg
gaaatcagccgcgcgcaactgtggcaatggctgcatcacggccgccatctcgatgacggc
accgccatcgaccagcacctgctcgacaccactctgcggcagttgccggcgcgcctgggc
accactgctggcatgccgggcggcgcacgtatcgccgaggccatcggcttgctcgaccaa
ctgagccgcgccgaggaattggccgacttcctcacggtgcctgcgtatcgcctgatcgac
tga

DBGET integrated database retrieval system