KEGG   Xanthomonas campestris pv. raphani: XCR_4276Help
Entry
XCR_4276          CDS       T01872                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCR_4276 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCR_4276 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    XCR_4276 (aceB)
Enzymes [BR:xcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XCR_4276 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4584582..4586204)
Genome map
AA seq 540 aa AA seqDB search
MSATAASARPAAADRATPGVSLTTQLAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRR
SRQAAFDAGQLPDFRTDTRAIRAGDWRVAELPAALQDRRVEITGPTDPKMVINALNSGAK
VFMADFEDSTAPTWRNLLTGQRTLAAAVRGELTFDAPNGKHYALRPEHERAVLIVRPRGW
HLDEKHVLIDGQPMAGGLFDAALFAFHNARTLMAKDRGPYLYLPKLQSMEEAALWETALA
HIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRARIVGLNCGRWDYIFSYLKTFRAH
PDRVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARV
RADKLREVSAGHDGTWVAHPALIAVAMAVFDEHMPTAHQHHVLRNDVQVTSDMLVATPPG
GITRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRAQLWQWLHHGRHLDDG
TAIDQHLLDTTLRQLPARLGTTAGMPGGARIAEAIGLLDQLSRAEELADFLTVPAYRLID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccgccgcttccgcccgtcccgccgccgctgaccgtgccacccccggcgtg
tcgctgaccacccagctggcgggccaggccgagctgctccccgctgccgcgctggctttg
ctggtgtcgctgcaccgggcgatcgagcccggccgccagcagcggctggcgcagcgtcgc
agccgtcaggccgcgttcgacgccggccagttgcccgacttccgcaccgacacccgcgcc
atccgcgccggcgactggcgcgtggccgaactgccggccgccctgcaggaccgccgggtc
gagatcaccggccccaccgatccgaagatggtcatcaacgcgctgaactccggcgccaag
gtgttcatggccgacttcgaagattccaccgcgcctacctggcgcaacctgctgaccggg
cagcgcacgttggcggccgcggtgcgcggcgagctcacattcgatgcgcccaacggcaag
cactacgcgctgcgtccggaacacgaacgtgcggtgctgatcgtgcgcccgcgtggctgg
cacctggacgagaagcacgtgttgatcgatggccagccgatggccggcggcttgttcgat
gcggcgctgttcgccttccacaacgcacgtacgctgatggccaaggaccgcggcccgtac
ctgtatctgcccaagttgcagagcatggaagaagccgcgctgtgggagaccgcgctggcg
catatcgaagcgatgctcggcctgccgcacgggcagatcaaggtcaccgtgctgatcgaa
acgctgccggcggtgttcgagatggacgagatcctgcacgccttgcgcgcacgcatcgtc
gggctcaattgcggccgttgggattacatcttttcgtacctgaaaacctttcgcgcacat
ccggaccgcgtgttgcccgagcgtggccaggtcaccatgacccagccgtttctcaaggcg
tattcggaactgctgatcaagacctgccatcgtcgcggcgcgcatgcgatgggcggcatg
gccgcgcagattccaatcaaccacgacgaggccgccaacgaacaggccatggcgcgtgtg
cgtgccgacaagctgcgcgaggtcagcgccggccatgacggcacctgggtggcgcacccg
gcactgattgcggtggcgatggcggtgttcgacgagcacatgcccaccgcgcatcaacac
catgtgctgcgtaacgatgtgcaggtgacctccgacatgttggttgccacaccgcccggc
ggcatcacccgcgccggtttcgagggcaatgtcgaggtctgcgtgcgttacctggccgcg
tggctggacggcaatggctgcgtgcccatccataacctgatggaagatgcggccactgcg
gaaatcagccgcgcgcaactgtggcaatggctgcatcacggccgccatctcgatgacggc
accgccatcgaccagcacctgctcgacaccactctgcggcagttgccggcgcgcctgggc
accactgctggcatgccgggcggcgcacgtatcgccgaggccatcggcttgctcgaccaa
ctgagccgcgccgaggaattggccgacttcctcacggtgcctgcgtatcgcctgatcgac
tga

DBGET integrated database retrieval system