KEGG   Xanthomonas campestris pv. raphani: XCR_4329Help
Entry
XCR_4329          CDS       T01872                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
xcp00860  Porphyrin and chlorophyll metabolism
xcp01100  Metabolic pathways
xcp01110  Biosynthesis of secondary metabolites
xcp01120  Microbial metabolism in diverse environments
Module
xcp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XCR_4329 (hemD)
Enzymes [BR:xcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XCR_4329 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEL09185
UniProt: G0CLZ2
Position
4637203..4638003
Genome map
AA seq 266 aa AA seqDB search
MLLSHNPEMTHTRTTATSWTLLSLRPNGEHAPLRRAVARHGGQLLAVSPWRLQINDTPQA
RDALRQALGAPIVVFTSPAAVHAAHRLLPLQRPGPAQWASVGEGTARALQACGIDAVVRP
ARMDSEGLLALPVFDAPLQAVGLVTAPGGRGMLAPALEQRGARILRADVYQRVALRLRAS
TLHALETEMPRSVMALSSSEALTLIVQQLPPSLATALKTRPVVASSDRMLEAARAAGFVQ
VHRAEGPLPAQLAAAAAAIMTPPPPC
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctctcgcataatcccgagatgacccacacgcgcacaactgccacgtcctggacc
ctgctgtcgctgcgtcccaacggcgagcacgcgccactgcggcgtgcggtggcccggcat
ggcggccagttgctggcggtgtcgccatggcgcctgcagatcaacgacacgccgcaggca
cgcgatgcgctgcggcaggcactgggcgcgccgattgtcgtgttcaccagcccggccgcc
gtgcacgcggcgcaccggctgctgcccttgcagcggcctggaccggcccagtgggcaagc
gtgggcgaaggcacggcgcgggcgctgcaggcctgcgggatcgacgcggtggtgcgcccg
gcgcgcatggacagcgaaggcctgctggcactgccggtgttcgatgccccgctgcaggcc
gtgggcctggtcaccgcgcccggcggccgcggcatgctggcgccggcgctggagcagcgc
ggtgcgcggatcctgcgcgcagatgtgtatcagcgtgttgcgctccggctgcgtgcgtcg
acgctgcacgcgctggagactgagatgccacgcagcgtgatggccttgagcagcagtgaa
gcgctgacgttgatcgtgcagcagttgccgccgtcattggccactgcattgaagacccgc
ccggtggtcgcctccagcgaccgcatgctggaagccgcccgcgctgccggcttcgtgcag
gtccatcgcgcggagggcccactgcctgcgcaattggcagccgccgccgctgcgatcatg
acgccgccgccaccttgctga

DBGET integrated database retrieval system