KEGG   Xanthomonas campestris pv. raphani: XCR_4404Help
Entry
XCR_4404          CDS       T01872                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4712953..4715103)
Genome map
AA seq 716 aa AA seqDB search
MTRALAEARHGDAFAVLGAHPSTNGRLLRTYHPGAEHVTAVLADGREVPLEAGPEPGLFA
GELPAEGGYRLRIGWPGGTQDTADPYAFGPLLSDFDLHLISEGHHLQLADALGANVVEVD
GVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQAGVWELFVPDVGPGAHYKYQLR
GPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQAHDAPMSIYEI
HAGSWLREEGLDLDWDGLADRLIPYVADMGFTHVELMPVTEHPFGGSWGYQPLGLFAPTA
RFGSPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEHADPREGFHRDW
NTLIYNHGRREVSGFLIASALEFLQRYHVDGLRVDAVASMLYRDYSRNAGEWVPNIHGGR
ENYETIAFLRRLNEVVREHAPGAVTIAEESTAWPGVTADVSHGGLGFHYKWNMGWMHDTL
HYIGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRMPGDDWQRFANL
RAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDARHRGVQTLVRDLNHLYAQ
YPALHAHDDDPSGFAWLVGDDAANSVVAFLRKGKRGDAPVLVVINYTPVVQQGYRLGVPQ
GGLWREVFNSDAGIYGGANLGNGGAVTAEPQSMHGHAQSLPLLLPPLGVIVLTPQG
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgccctggccgaagcgcggcacggcgatgcattcgccgtgctgggcgcacat
cccagcaccaacggccgcctgctgcgcacctatcaccccggcgccgagcacgtcaccgcc
gtgctggcggatgggcgcgaggtaccgctggaagccggcccggaaccaggcctgtttgcc
ggcgaattgccggccgagggaggctaccgcctaaggatcggctggccgggcggcacccag
gacaccgcagacccgtacgcgttcgggccgctgctcagcgacttcgacctgcacctgatc
agcgaaggccaccatctgcagctggccgatgcgctgggcgccaatgtggtggaagtggac
ggcgtgcgcggtacgcgctttgcggtgtgggcaccgaacgcctcgcgcgtggcggtggtg
ggcgacttcaatagctgggacgcgcgccggcacccgatgcggctgcgccaccaggccggc
gtgtgggagctgttcgtgcccgacgtgggccccggcgcgcactacaaatatcagctgcgt
ggcccgcatgggcatgaactgccggccaaggccgacccggtggcacgccgcgccgaactg
gcgccgggcactgcctcgatcgtggccgaccccacgccgcaccagtggagcgacgacggc
tggatggccacgcgtgcgcgccgccaggcgcacgacgcaccgatgagcatctacgagatc
catgccggctcctggctgcgcgaggaaggcctggatctggattgggatggcctggccgat
cgcctgattccgtacgtggccgacatgggcttcacccatgtggagctgatgccggtgacc
gagcatccgttcggtggctcgtggggctaccagccgttgggcctgttcgcgcccaccgcg
cgcttcggcagcccggatggctttgcgcgctttgtcgaccgctgccaccgcgaaggcatc
ggcgtgatcgtggactgggtgccggcacactttcccaccgacgcgcacggcctggcccac
ttcgacggcaccgcgctgtatgaacacgccgacccgcgcgagggcttccatcgcgactgg
aatacgctgatctacaaccatggccgccgcgaggtgtctggctttctgatcgccagcgcg
ctggagttcctgcagcgctatcacgtcgatggcctgcgcgtggatgcggtggcctcgatg
ctctaccgcgactacagccgcaacgccggtgagtgggtgcccaacatccatggcggccgc
gaaaactacgagaccatcgcgttcctgcgccggctcaacgaggtggtgcgcgagcacgcg
ccgggtgcggtgaccattgccgaagaatccaccgcctggccgggcgtgaccgcggatgtg
tcgcatggcggcctgggcttccactacaagtggaacatgggctggatgcacgacacgctg
cattacatcgggctggacccgatctatcgccgctaccaccatggcgagctgactttcagc
atggtgtacgcgtactcggagcgcttcgtgctgccgatctcgcacgacgaagtggtgcac
ggcaagggctccttgctgggccgcatgcccggtgacgattggcagcgtttcgccaacctg
cgcgcctatctcggtttcatgttcactcacccgggacgcaagttgctgttcatgggctgc
gagttcggccagcccaccgagtggaaccacgacgccggcttgccgtggcatctgctcgac
gacgcacgccaccgcggcgtgcagacgctggtgcgcgacctcaaccacctgtacgcgcaa
taccccgccttgcacgcgcacgacgacgacccatcgggcttcgcgtggctggtaggcgat
gacgcggccaacagcgtggtggcgttcctgcgcaagggcaaacgcggcgatgcaccggtg
ctggtggtgatcaactacaccccggtggtgcagcaggggtatcgcctcggagtgccgcag
ggcggcctgtggcgcgaagtgttcaacagcgacgccggcatctacggcggtgccaatctg
ggtaacggcggtgcagtgactgccgagccacagtccatgcatggccacgcgcagtcgctg
ccgttgctgctgccgccgctgggcgtcatcgtgctgaccccgcagggctga

DBGET integrated database retrieval system