KEGG   Xanthomonas campestris pv. raphani: XCR_4421Help
Entry
XCR_4421          CDS       T01872                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xcp00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xcp00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4733228..4734568
Genome map
AA seq 446 aa AA seqDB search
MSNTVFIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKQVAGKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGNTALARAEAKSDAAFEFFTKLGVPYYCFHDIDLAPDADDI
GEYENNLKHMVGIAKQRQADTGVKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRAIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVADALLTSSPLETWRAQRYASFDSGAGADFANGTSTLADLAKYA
AGKGEPTQVSGRQEAYENLINQYLTR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgttttcatcggcgcgaaagaatatttccccggcatcggcaagatcggc
ttcgaaggccgcgattcggacaacccgcttgcgttcaaggtgtacgacgccaacaagcag
gtcgccggcaagaccatggccgagcacctgcgctttgcagtggcttactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggcacgcgtgcgtatccgtgggatgtgggc
aacaccgcgctggcacgtgccgaggccaagtccgatgccgcgttcgaattcttcaccaag
ctcggcgtgccgtactactgcttccacgacatcgatctggcgccggatgcggacgacatc
ggcgagtacgaaaacaacctcaagcacatggtgggcattgccaagcagcgccaggccgac
accggcgtcaagctgctgtggggcaccgccaatctgttctcgcacccgcgctacatgaat
ggtgcgtccaccaatccggacttcaatgtcgtggcgcgcgctgcggtgcaggtcaaggcc
gcgatcgatgccacggtggagctgggcggcgagaactacgtattctggggcggccgcgaa
ggctatgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcacgcgactacgggcgtgcgatcggcttcaaaggcaacttcctgatcgag
cccaagcccatggagccgatgaagcaccagtacgatttcgacagcgccacggtgatcggc
ttcctgcgccagcacggcctggaccaggatttcaagctcaatatcgaagccaaccacgcc
acgctgtcgggtcacagcttcgagcacgacctgcaggtggccagcgatgccggcctgctt
ggcagcatcgatgccaaccgcggcaacccgcagaacggctgggataccgaccagttcccg
accgacctgtacgacaccgtcggcgcgatgctggtggtgctgcgtcagggcgggctggca
ccgggcggtctgaatttcgatgccaaggtgcggcgtgagtcatccgatccgcaggatctg
ttcctggcacacatcggcggcatggatgcgttcgcacgcgggctggaagtggccgacgcg
ctgctgacctcctcaccgctggaaacctggcgcgcgcagcgttacgccagcttcgacagc
ggcgcgggcgcggactttgccaacggcaccagcacgctggcggatctggccaagtacgcc
gccggcaagggcgagccgacgcaagtcagcggccgccaggaagcctacgagaacctgatc
aatcagtatctgacgcgttga

DBGET integrated database retrieval system