KEGG   Xanthomonas campestris pv. raphani: XCR_4493Help
Entry
XCR_4493          CDS       T01872                                 

Definition
transglycosylase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCR_4493
Enzymes [BR:xcp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XCR_4493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4822783..4824942)
Genome map
AA seq 719 aa AA seqDB search
MTPLRRALPLLLGLAPFAAWADPAFDRCLAGLQTQAAAKGVDAASFQRFTAGLAADPSVL
PLLDAQPEFTTPIWDYLASLVDSQRVSDGQAMLVTHRELLTRLSEQTGVDPATIVAVWGV
ESDYGRITGKRPLLVSLATLSCAGRRQPFFRGEFLSLLGLLQQGDLAPEGLTGSWAGAFG
QTQFMPSTYARIAVDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGMEVRLPAGF
DANKAGRTRRQPLQAWQAAGLLGTDGKPLAPTGLPAETAAALLLPAGPTGPAFLVFRNYD
AIYAYNAAESYALSIALLADRLRSGPGLVAAWPTDDPGLGRPERRQLQQLLLARGHQIGE
ADGMVGTATRRAIQVEQTRLGLQPADGRAGQRILTALRTAPPVTGAAVRGTAFTLPAAYP
AFVQSPIVQKASPMSDVTGLRTGDFHGFPSLLIDTPYSTAAISLFGGQLLSFVPKGGQDV
MWLSPTAKQPPTPIRGGAPVCWPYFGRQDQTGDVPAHGFVRTVPWQLTESRREDDGTLVL
TLTPPTFDDLALRLHMTLRIGRKLEQRLVTENVSKAPVRFTQALHNYFRVGDALKVSVQG
LDGLDYLDKYENYATAHRQQGDWSLRDPRDPGRSDRIYTNAGGHYTLTDPVLGRRIDIRT
EGSRSLVAWNPGEDAASKMADVGAGWRDYVCLEAANAGPDVIELAPGASHTLGQTISVE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgctgcggcgcgcgttgccgctgctgctgggcctggcgccgttcgccgcctgg
gccgaccccgcgttcgaccgctgcctggccgggctgcagacccaggccgccgccaagggg
gtggatgccgccagcttccagcgcttcaccgccggtctggccgccgatcccagcgtgttg
ccgctgctggacgcgcaaccggaattcaccaccccgatctgggactatctggccagcctg
gtcgatagccagcgcgtgagcgatggtcaggccatgttggtgactcaccgcgagctgctc
acccgcctgtccgaacaaaccggcgtggacccggccaccatcgtggcggtgtggggcgtg
gagagcgactacggccgcatcaccggcaagcgcccattgctggtgtcgctggccacgctg
tcgtgcgccggccgccgccagccgttcttccgcggcgaattcctgtccctgctcggcttg
ttgcagcagggcgacctggcgcccgaggggctgaccggctcctgggccggcgcgttcggg
cagacccagttcatgccgtccacctatgcgcgcatcgccgtcgacggcgatggcgatggc
cgccgcgacctggtcgccagcattcccgacgcgctggcctccaccgccaactatttggtc
aaggccggctgggaacgcgcccgcccctggggcatggaagtgcgcctgccggccggcttc
gacgccaacaaggccggccgcacccgccgccaaccgctgcaggcctggcaggccgccggc
ctgctcggcaccgacggcaagccgctcgccccgaccgggctgccggccgagaccgccgcc
gccctgttgctgccggccggccccaccggtcctgcatttctggtgttccgtaactacgac
gcgatctacgcctacaacgcggccgaaagctacgcgctctcgatcgcgctgctggccgat
cgcctgcgcagtggccccggcctggtcgccgcctggcccaccgacgaccccggcctgggc
cggcccgaacgccggcaactgcagcaactgctgctggcccgcggccaccagatcggcgaa
gccgatggcatggtcggcaccgccacccgccgcgccatccaggtcgagcagacccgcctg
ggcctgcagccggccgatggtcgcgccggccaacgcatcctcaccgccttgcgcaccgcc
ccgccggtgaccggcgccgccgttcgcggcaccgcgttcacgctgccggcggcctatccc
gcattcgtccaatctcccatcgtccagaaggcatctcccatgtccgacgtcaccggcctg
cgcacaggcgacttccacggttttccctcgctgctgatcgataccccgtattccaccgcg
gccatcagcctgttcggcggccaactgctgtcgttcgtgcccaagggcgggcaggacgtg
atgtggctgtcgcccaccgccaagcagccgcccacgcccatccgcggcggcgcgccggtg
tgctggccgtatttcggccgccaggatcagaccggcgacgtgccggcgcacggctttgtc
cgcacggtgccgtggcagctcaccgagagccgccgcgaagacgacggcacgctggtgctc
acgctgacgccgccgaccttcgatgacctggcgctgcgcctgcacatgaccctgcgcatc
ggccgcaagctagaacaacgcctggtcaccgaaaacgtcagcaaggcgccggtgcgcttc
acccaggccctgcacaactacttccgcgtcggcgacgcgctcaaggtgagcgtgcagggc
ctggatgggctggactatctcgacaagtacgagaactacgccaccgcgcaccgccagcag
ggcgactggagcctgcgcgatccgcgcgaccccggccgcagcgaccgcatctacaccaac
gccggcggccactacaccctcaccgacccggtgctgggccgccgcatcgacatccgcacc
gaaggcagccgctcgctggtggcctggaatccgggcgaagacgccgccagcaagatggcc
gacgtcggcgccggctggcgcgactacgtctgcctggaagccgccaacgccggcccggac
gtgatcgagctggcgcccggtgccagccacacgctgggccagaccatcagcgtggaataa

DBGET integrated database retrieval system