KEGG   Xanthomonas campestris pv. raphani: XCR_4558Help
Entry
XCR_4558          CDS       T01872                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xcp  Xanthomonas campestris pv. raphani
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xcp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xcp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4894670..4895215)
Genome map
AA seq 181 aa AA seqDB search
MSQSIHDIPVTDINGGATSLAAHRGKVLLVVNVASKCGLTPQYEGLEALYRDKQAQGLEV
LGFPANDFNGQEPGSEAEIAQFCQLTYDVTFPLFSKIAVTGAEIHPLYQALTSAQPQATG
DGPMREKLAGYGIAANPAPGVLWNFEKFLIGRDGQVIERFAPDVAADDVRLRQAVDAALA
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcatccacgacattcccgtgaccgacatcaacggtggcgccaccagcctg
gccgcgcatcgcggcaaggtgttgctggtggtcaacgttgcctccaagtgcgggctcacc
ccgcagtacgaaggcctggaagcgctgtaccgcgacaagcaggcccagggcctggaagtg
ctgggtttcccggccaacgacttcaatgggcaggagcccggcagcgaggcggagatcgcc
cagttctgccagctcacctatgacgtcaccttcccgctgttctccaagatcgccgttacc
ggcgccgagatccatccgctgtaccaggcgctgaccagcgcacagccgcaggccaccggc
gatggcccgatgcgcgaaaagctggccggctacggcatcgccgccaacccggcaccgggc
gtgctgtggaacttcgaaaaattcctgatcggccgcgatggccaggtcatcgaacgcttc
gcacccgacgtcgccgccgatgacgtccgcctacgtcaggccgtggatgcggcgttggcg
cactaa

DBGET integrated database retrieval system