KEGG   Xanthomonas campestris pv. vesicatoria: XCV0033Help
Entry
XCV0033           CDS       T00288                                 

Gene name
egl3
Definition
cellulase precursor (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCV0033 (egl3)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XCV0033 (egl3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(35167..36240)
Genome map
AA seq 357 aa AA seqDB search
MFRTPPHFPRLRIAALALTLLAATPLVQAKEPPGPKKDTAGLKYVGVNLSGAEFNSRKKP
GTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGQLDQAQLGLIKKSLEAAKA
NKQYLILDLHNYATYNGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISA
PDWANAAQGTINAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDSGNNLA
FEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALE
GMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFNVQPGKDGSDKPQMAILSKYARRAGK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcactcccccgcactttccccgcttgcgcatcgccgcgctcgcgttgaccttg
ctcgccgccaccccactggtccaggccaaggagccgcccggcccgaagaaggacaccgcc
ggcctgaagtatgtcggagtcaatctgtccggcgccgagttcaactcgcgcaagaagccc
ggcaccttgttcaaggattacacctaccctgccgcctcggatttcagctatttcgccggc
aaaggcatgaatacgatccgcctgccgtttctgtgggaacgcgtgcagcccgagctcaat
ggtcagctggaccaggcccaattgggcttgatcaagaagtcgcttgaagcagccaaggcc
aacaagcaatacctgatcctggatctgcacaactacgccacgtacaacggcaagcgcatc
ggcaccagcgatgtgccggccggcgcgttggccgatctgtggcgccggctggcgctggag
ttcaaggacgacaaggcggtgatcttcgggctgatgaacgagcccaatggcatttccgca
cccgactgggccaatgccgcgcaggggacgatcaacgcgatccgcaagaccggcgcgaag
aacctgatcctggtgccgggcaccgcctacaccggcgcacacagctggcgcagcaccagc
tacggcgtctccaacgcaaaggcgctggaaatcctcaaggactcgggcaacaacctggcc
ttcgaagcgcatcagtacctggacaaggactacagcggcaccaagccggtgtgcaccagc
gactcggtaggccaagaaaagctgcagggcttcacttcgtggttgcgcgagaacaagcag
aagggttttctgggcgaattcgccacggccaacaatccggtctgcgacaaggcgctggaa
ggcatgctgacctacatggaaaagaacagcgacgtgtggctgggctggacctggtgggcg
gcgggcgcctggtggaagccggactatcccttcaacgtgcaaccgggcaaggacggcagc
gacaagccgcagatggcgatcctgagcaagtacgcacgccgcgccggcaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system