KEGG   Xanthomonas campestris pv. vesicatoria: XCV0264Help
Entry
XCV0264           CDS       T00288                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCV0264
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCV0264
   00630 Glyoxylate and dicarboxylate metabolism
    XCV0264
Enzymes [BR:xcv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XCV0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304424..306058
Genome map
AA seq 544 aa AA seqDB search
MHKDSHMAATAFAPRPTDHATPGIALTTQIAGQAELLPAAALALLVSLHRAIEPGRQQRL
AQRRQRQAAFDAGQLPDFRTDTQAIRAGDWRVAPLPAALQDRRVEITGPTDPKMVINALN
SGAKVFMADFEDSTAPTWRNLLAGQRTLAAAVRGDLSFDAPNGKHYALRPEAERAVLIVR
PRGWHLDEKHVLIDGQPLAGGLFDAALFAFHNGRALLAKDRGPYLYLPKLQSMEEAALWD
TALAHIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRERIVGLNCGRWDYIFSYLKT
FRAHRDRVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQA
MARVRADKLREVTAGHDGTWVAHPALIPVAMKLFDEHMPTAHQQHVVRNDVQVTRDMLIA
PSPGNVTRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRAQLWQWLHHGQH
LDDGTAIDQHLLQATLRALPARLGTATALPGAARIDEAIALLEELSRADELADFLTVPAY
RLID
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggactcccacatggctgccaccgcgtttgctccccgtcccaccgaccacgcc
acgcccggcattgcgctgaccacccagatcgccggccaggcggagctgctgccggccgct
gcgctggccctgctggtttcgctgcaccgggcgatcgagcccggccgccagcagcgtctg
gcccagcggcgccagcgccaggccgctttcgatgccggtcagctgccggacttccgtacc
gatacccaggccatccgcgccggcgattggcgcgtggctcccctgccggcggcactgcag
gaccgccgtgtcgaaatcaccggcccgaccgacccgaagatggtcatcaacgcgctgaac
tccggcgccaaggtgttcatggccgacttcgaagattccaccgcgccgacctggcgcaac
ctgctggccggccagcgcaccctggctgcggcggtgcgcggtgacctcagcttcgatgcg
cccaacggcaagcactacgccctgcgcccggaggccgaacgtgcagtgctgatcgtgcgc
ccgcgcggctggcacctggacgaaaagcacgtgttgatcgacggccagccgctggccggc
ggcctgttcgatgcggcgctgtttgccttccacaatggccgtgcgttgctggccaaggac
cgcggcccgtacctgtacctgcccaagctgcagagcatggaagaagccgccctgtgggac
accgcgctggcgcatatcgaagcgatgctgggcctgccgcatgggcagatcaaggtcacc
gtgctgatcgaaacgctgccggcggtgttcgagatggacgaaattctccacgcgctgcgc
gagcgcatcgtgggcctgaactgcgggcgttgggactatatcttttcctacctgaaaacc
tttcgtgcgcaccgcgaccgcgtgctgcccgaacgcggccaggtcaccatgacccagcca
tttttgaaggcctattcggagctgttgatcaagacctgccatcgccgcggtgcgcatgcg
atgggcggcatggccgcgcagattccgatcaatcacgatgaagccgccaacgaacaggcc
atggcccgcgtgcgtgccgacaagttgcgcgaagtgaccgccggccacgatggcacctgg
gtggcgcatccggcgctgattccggtggcgatgaaactgttcgacgaacacatgcccacc
gcgcatcagcagcatgtagtgcgcaatgacgtgcaggtgacgcgcgacatgttgatcgcg
ccctcgccgggcaatgtcacccgcgccgggttcgaaggcaatgtcgaagtgtgcgtgcgc
tatctggcggcctggctggacggcaatggctgcgtgccgatccaccacctgatggaagac
gccgccacggccgaaatcagccgcgcgcagctgtggcaatggttgcatcacggccagcac
ctggatgatggcaccgccatcgatcaacacttgctgcaggccaccttgcgcgcactgcct
gcacggctgggaaccgccaccgcgctgcccggcgctgcacggatcgatgaagcgatcgcc
ttactcgaagagttgagccgcgccgacgaactggcggacttccttaccgtaccggcgtac
cgccttatcgattga

DBGET integrated database retrieval system