KEGG   Xanthomonas campestris pv. vesicatoria: XCV0264Help
Entry
XCV0264           CDS       T00288                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:xcv01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:xcv00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:xcv00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304424..306058
Genome map
AA seq 544 aa AA seqDB search
MHKDSHMAATAFAPRPTDHATPGIALTTQIAGQAELLPAAALALLVSLHRAIEPGRQQRL
AQRRQRQAAFDAGQLPDFRTDTQAIRAGDWRVAPLPAALQDRRVEITGPTDPKMVINALN
SGAKVFMADFEDSTAPTWRNLLAGQRTLAAAVRGDLSFDAPNGKHYALRPEAERAVLIVR
PRGWHLDEKHVLIDGQPLAGGLFDAALFAFHNGRALLAKDRGPYLYLPKLQSMEEAALWD
TALAHIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRERIVGLNCGRWDYIFSYLKT
FRAHRDRVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQA
MARVRADKLREVTAGHDGTWVAHPALIPVAMKLFDEHMPTAHQQHVVRNDVQVTRDMLIA
PSPGNVTRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRAQLWQWLHHGQH
LDDGTAIDQHLLQATLRALPARLGTATALPGAARIDEAIALLEELSRADELADFLTVPAY
RLID
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggactcccacatggctgccaccgcgtttgctccccgtcccaccgaccacgcc
acgcccggcattgcgctgaccacccagatcgccggccaggcggagctgctgccggccgct
gcgctggccctgctggtttcgctgcaccgggcgatcgagcccggccgccagcagcgtctg
gcccagcggcgccagcgccaggccgctttcgatgccggtcagctgccggacttccgtacc
gatacccaggccatccgcgccggcgattggcgcgtggctcccctgccggcggcactgcag
gaccgccgtgtcgaaatcaccggcccgaccgacccgaagatggtcatcaacgcgctgaac
tccggcgccaaggtgttcatggccgacttcgaagattccaccgcgccgacctggcgcaac
ctgctggccggccagcgcaccctggctgcggcggtgcgcggtgacctcagcttcgatgcg
cccaacggcaagcactacgccctgcgcccggaggccgaacgtgcagtgctgatcgtgcgc
ccgcgcggctggcacctggacgaaaagcacgtgttgatcgacggccagccgctggccggc
ggcctgttcgatgcggcgctgtttgccttccacaatggccgtgcgttgctggccaaggac
cgcggcccgtacctgtacctgcccaagctgcagagcatggaagaagccgccctgtgggac
accgcgctggcgcatatcgaagcgatgctgggcctgccgcatgggcagatcaaggtcacc
gtgctgatcgaaacgctgccggcggtgttcgagatggacgaaattctccacgcgctgcgc
gagcgcatcgtgggcctgaactgcgggcgttgggactatatcttttcctacctgaaaacc
tttcgtgcgcaccgcgaccgcgtgctgcccgaacgcggccaggtcaccatgacccagcca
tttttgaaggcctattcggagctgttgatcaagacctgccatcgccgcggtgcgcatgcg
atgggcggcatggccgcgcagattccgatcaatcacgatgaagccgccaacgaacaggcc
atggcccgcgtgcgtgccgacaagttgcgcgaagtgaccgccggccacgatggcacctgg
gtggcgcatccggcgctgattccggtggcgatgaaactgttcgacgaacacatgcccacc
gcgcatcagcagcatgtagtgcgcaatgacgtgcaggtgacgcgcgacatgttgatcgcg
ccctcgccgggcaatgtcacccgcgccgggttcgaaggcaatgtcgaagtgtgcgtgcgc
tatctggcggcctggctggacggcaatggctgcgtgccgatccaccacctgatggaagac
gccgccacggccgaaatcagccgcgcgcagctgtggcaatggttgcatcacggccagcac
ctggatgatggcaccgccatcgatcaacacttgctgcaggccaccttgcgcgcactgcct
gcacggctgggaaccgccaccgcgctgcccggcgctgcacggatcgatgaagcgatcgcc
ttactcgaagagttgagccgcgccgacgaactggcggacttccttaccgtaccggcgtac
cgccttatcgattga

DBGET integrated database retrieval system