KEGG   Xanthomonas campestris pv. vesicatoria: XCV0265Help
Entry
XCV0265           CDS       T00288                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCV0265 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XCV0265 (aceA)
Enzymes [BR:xcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XCV0265 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306218..307513
Genome map
AA seq 431 aa AA seqDB search
MSTTLQSAEQLQQDWSNNPRWSGITRNYSAADVVRLRGTVHVEHSLARLGAEKLWTSLHA
TPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVK
RINNTLLRADQLHHAEGNDAIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDA
NDQPFTTGQRTVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHALNYGMFHLAH
GYARRQMSAFVELQQAEFEAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALRGST
EEAQFHSDKAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacactgcaaagcgccgaacaactgcagcaggactggtccaacaacccgcgc
tggagcggcatcacccgcaattacagcgctgccgatgtggtgcgcctgcgtggcaccgtg
catgtcgagcactcgctggcgcggttgggcgcggaaaaattgtggacctcattgcatgcc
acgccgttcgtcaatgcgctgggcgcattgaccggcaaccaggccatgcagcaggtcaag
gccggcttgaaggcgatttacctgagcggctggcaggttgccgccgacgccaatctggcc
gggcagatgtatccggaccaatcgctgtacccggccgattcggtgccggcggtggtcaag
cgcatcaacaacaccttgctgcgcgccgaccagttgcaccatgccgaaggcaacgatgcc
atcgacttcctgcagccgatcgtggccgacgccgaagccggtttcggtggcgtgctcaac
gccttcgaactgatgaaggcgatgatcgaagccggcgcggctggcgtgcacttcgaagac
caactggcctcggtcaagaagtgcggccacatgggcggcaaggtgctggtgcccacgcgt
gaggcgatcgaaaaattgaatgccgcgcgcctggctgccgacgtgctgggcgtgccgacg
gtgctgatcgcacgcaccgacgccgaagccgccgacctgatcaccagcgacgtggatgcc
aacgaccaaccgttcaccaccgggcagcgcacggtcgaaggcttctttaagacccgcaat
ggcctggaccaggcgatcagccgcggcttggcctatgccccgtacgccgacctgatctgg
tgcgaaaccggcaagccggacctggaatttgcgcgtgcgtttgcgcaggccatccatgcc
aggttccccggcaaattgctggcctacaactgctcgccgagtttcaattggaagaagaat
ctggacgatgccaccatcgccaaattccagaccgaactggcgagctatggctacaagttc
cagttcatcaccctggctggcttccacgccttgaactacggcatgttccatctggcgcac
ggctatgcgcgccggcagatgagtgcgttcgtcgaattgcagcaggccgagttcgaagcg
gcggagaggggatttaccgcagtcaagcaccagcgcgaagtaggcaccggctatttcgat
gcagtgacgcaggcgatccagcaggggcaatcgtccaccaccgccttgcgtggctccacc
gaagaagcgcaattccatagcgacaaggcggcctga

DBGET integrated database retrieval system