KEGG   Xanthomonas campestris pv. vesicatoria: XCV0517Help
Entry
XCV0517           CDS       T00288                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
xcv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcv01100  Metabolic pathways
xcv01110  Biosynthesis of secondary metabolites
xcv01130  Biosynthesis of antibiotics
xcv01230  Biosynthesis of amino acids
Module
xcv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCV0517 (trpC)
Enzymes [BR:xcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XCV0517 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAJ22148
UniProt: Q3BYB5
Position
584542..585339
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAMQASIAAGDPAVIAEV
KKASPSKGVIRPDFQPADIAVSYEFGGATCLSVLTDVDFFQGSDAYLRQARDACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDAQLADLSGLAMQLGLDVLVEVHDIDELERA
VQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRDRVLVTESGIVTQADVQLMRSHDVNA
FLVGETFMRAAEPGESLRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcaacaccattcttgcccgcaaggccgacgaagtcgccgagcgcagt
gcgcgcgtgccgctggccgagttgatcgcgcgcagcgccgacctaccgctcacgcgcgga
tttgcagctgccatgcaggccagcatcgccgcaggcgacccggccgtgatcgccgaagtg
aagaaggccagcccgtccaagggtgtcatccggccggacttccagccggccgatatcgcg
gtcagctatgaattcggtggcgcgacgtgcctgtcggtgctcaccgatgtggatttcttc
cagggatcggatgcctatctgcgccaggcgcgcgacgcctgcacgctgccggtgctgcgc
aaggatttcaccgtcgacccgtatcaggtctacgaagcccgcgtgctcggcgccgactgc
atcctgctgatcgtctccgcgctggaagacgcccaactggccgatctatcgggcctggcc
atgcagctgggcctggacgtgctggtggaagtacacgacatcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgttgatcggcatcaacaatcgcaacctgcgcaccttcgaagtg
acgctgcagaccacgttggacatgcgcgcggcggtgccgcgcgatcgcgtgctggtcacc
gagagcggcatcgtcacccaggccgatgtgcaactgatgcgcagtcacgatgtgaacgcg
tttctggtcggcgagaccttcatgcgcgcggccgaacccggcgagtcgctgcgtcagcta
ttcttcgcgcatgactga

DBGET integrated database retrieval system