KEGG   Xanthomonas campestris pv. vesicatoria: XCV0670Help
Entry
XCV0670           CDS       T00288                                 

Gene name
engXCA
Definition
extracellular endoglucanase precursor (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcv  Xanthomonas campestris pv. vesicatoria
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCV0670 (engXCA)
Enzymes [BR:xcv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XCV0670 (engXCA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(758663..760093)
Genome map
AA seq 476 aa AA seqDB search
MPIFRTASTLALATMLALTAAPAFSYSVSNNKIVDDNGNVVQLKGVNVFGFETGNHVMHG
LWARNWKEMINQMQGLGFNAVRLPFCPATLRSGQMPSSIDYSRNADLQGLTSLQILDKVI
NEFNARGMYVLLDHHTPDCAAISELWYTSSYSEAQWLDDLRFVANRYKNVPRVIGVDLKN
EPHGAATWGTGNAATDWNKAAERGSAAVLAVAPKWIIAVEGITDNPVCSTNGGIFWGGSL
QPLACTPLNIPANRLLLAPHVYGPDVFVQSYFNDSNFPNNMPAIWDRHFGQFAGNHALLL
GEFGGKYGEGDARDKVWQDALVKYLRGKGINEGFYWSWNPNSGDTGGILRDDWISVREDK
MTLLRTLWGTVSNSTPTPTPTPTPTPTPTPTPSAGFSTKVIPDSRWNGGYCNRVQVTNTG
TASGNWSISLTVTGTVNNAWNVTWSQSGTTLQASGVDFNRTLAPGATAEFGFCAAG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcccattttcaggactgcaagtacgctcgcattggcaacgatgttagcgctcacagcc
gcaccggctttcagctattcggtcagcaacaacaagatcgtcgacgacaacggcaacgtg
gttcagctcaagggcgtcaacgtgttcggcttcgagaccggcaaccatgtcatgcatggc
ctgtgggcacgcaactggaaggagatgatcaaccagatgcagggcctgggcttcaacgcg
gtgcgcctgccgttttgcccggccacgctgcgtagcggccagatgcccagcagcatcgac
tacagccgcaacgccgatctgcagggcctgacctcgctgcagatcctcgacaaggtgatc
aacgaattcaacgcacgcggcatgtatgtgctgctggatcaccacacgcccgattgcgcg
gcgatttccgagctgtggtacaccagttcatattccgaagcgcaatggctggacgatctg
cgctttgtcgccaaccgctacaagaacgtgccgagggtgatcggcgtggatctgaagaac
gagccgcacggcgccgcgacctggggcacgggcaacgccgccaccgactggaacaaggcc
gccgagcgcggttctgccgccgtgcttgcggtggcgccgaagtggatcattgcggtggaa
ggcatcaccgacaacccggtgtgttcgaccaatggcggcatcttctggggtggcagcctg
cagccgctggcctgcaccccattgaacattccggccaaccgactgttgctggcaccgcat
gtgtacggcccggacgtgttcgtgcagtcgtacttcaacgacagcaacttccccaacaac
atgcctgcgatctgggaccgccatttcggccagtttgccggcaatcacgcactgctgctg
ggcgaattcggcggcaagtacggcgaaggcgatgcgcgcgacaaagtctggcaggacgcg
ctggtgaagtacctgcgtggcaagggcatcaacgaagggttctattggtcgtggaacccc
aatagcggcgataccggcggcatcctgcgcgacgactggatcagcgtgcgcgaagacaag
atgaccttgttgcggacgctgtggggaacggtaagcaacagcacaccgacgccaacgccg
acaccgacgccgacaccgacgccaaccccgacgccaagcgcgggcttcagtaccaaggtg
atcccggacagtaggtggaacggaggctactgcaaccgcgtgcaggtcaccaataccggc
accgccagcggcaactggtcgatctcgctgacagtcaccggcaccgtcaacaacgcctgg
aacgttacctggtcacagagcggcaccacactccaggccagcggcgtggacttcaaccgc
acgctggcgcccggcgccactgccgagttcggcttctgcgctgcaggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system